G61N oxidized flavodoxin mutant. Determined by X-ray diffraction at 1.8 Å resolution. Released 27 May 1998.
Explore 1AKT in 3D Show helices and sheets RCSB PDB PDBe
1AKT contains 8 α-helices and 8 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 1 |
| α-helix | 14-28 | 15 | |
| β-strand | 32-37 | 6 | 1 |
| α-helix | 38-40 | 3 | |
| β-strand | 52-57 | 6 | 1 |
| β-strand | 59 | 1 | 2 |
| β-strand | 67 | 1 | 2 |
| α-helix | 72-76 | 5 | |
| α-helix | 78-80 | 3 | |
| β-strand | 87-94 | 8 | 1 |
| α-helix | 103-114 | 12 | |
| β-strand | 118-119 | 2 | 1 |
| α-helix | 122-123 | 2 | |
| β-strand | 124-127 | 4 | 1 |
| α-helix | 130-133 | 4 | |
| α-helix | 134-147 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Flavodoxin | A | protein | 147 | Desulfovibrio vulgaris subsp. vulgaris str. Hildenborough | P00323 (AlphaFold model) |
>1AKT_1 FLAVODOXIN (chains A) PKALIVYGSTTGNTEYTAETIARELADAGYEVDSRDAASVEAGGLFEGFDLVLLGCSTWN DDSIELQDDFIPLFDSLEETGAQGRKVACFGCGDSSYEYFCGAVDAIEEKLKNLGAEIVQ DGLRIDGDPRAARDDIVGWAHDVRGAI
| ID | Name | Formula | Copies |
|---|---|---|---|
| FMN | Flavin mononucleotide | C17 H21 N4 O9 P | 1 |
Modulation of the redox potentials of FMN in Desulfovibrio vulgaris flavodoxin: thermodynamic properties and crystal structures of glycine-61 mutants. O'Farrell, P.A., Walsh, M.A., McCarthy, A.A. et al. Biochemistry (1998) 37:8405-8416. DOI 10.1021/bi973193k · PubMed
Other PDB entries of the same protein (UniProt P00323 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1AKT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.