1ALU: Human interleukin-6

Human interleukin-6. Determined by X-ray diffraction at 1.9 Å resolution. Released 3 Jun 1998.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,413
Mol. weight: 21.67 kDa
Ligands: TLA
Released: 3 Jun 1998

Explore 1ALU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ALU contains 7 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	21-47	27
α-helix	69-71	3
α-helix	80-104	25
α-helix	109-129	21
α-helix	135-137	3
α-helix	141-152	12
α-helix	156-181	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-6	A	protein	186	Homo sapiens	P05231 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ALU_1 INTERLEUKIN-6 (chains A)
MAPVPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNMCESSKEALA
ENNLNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMS
TKVLIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSL
RALRQM

Ligands and cofactors

ID	Name	Formula	Copies
TLA	L(+)-tartaric acid	C4 H6 O6	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

1.9 A crystal structure of interleukin 6: implications for a novel mode of receptor dimerization and signaling. Somers, W., Stahl, M., Seehra, J.S. EMBO J (1997) 16:989-997. DOI 10.1093/emboj/16.5.989 · PubMed

Other PDB entries of the same protein (UniProt P05231 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7NXZ 2.0 Å, Synthetic glycoform of Human Interleukin 6
4CNI 2.2 Å, Crystal structure of the Fab portion of Olokizumab in complex with IL- 6
4J4L 2.3 Å, Modular evolution and design of the protein binding interface
4NI7 2.4 Å, Crystal structure of human interleukin 6 in complex with a modified nucleotide aptamer…
4O9H 2.42 Å, Structure of Interleukin-6 in complex with a Camelid Fab fragment
8YWQ 2.51 Å, Crystal structure of the Fab fragment of the anti-IL-6 antibody I9H in complex with a…
4NI9 2.55 Å, Crystal structure of human interleukin 6 in complex with a modified nucleotide aptamer…
5FUC 2.7 Å, Biophysical and cellular characterisation of a junctional epitope antibody that locks…
4ZS7 2.93 Å, Structural mimicry of receptor interaction by antagonistic IL-6 antibodies
8YWR 2.93 Å, Crystal structure of the Fab fragment of the anti-IL-6 antibody 68F2 in complex with a…
8QY5 3.1 Å, Structure of interleukin 6.
8QY6 3.16 Å, Structure of interleukin 6 (gp130 P496L mutant).

Browse structure collections

About this viewer

MolViewer shows 1ALU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.