7NXZ: Synthetic glycoform of Human Interleukin 6

Synthetic glycoform of Human Interleukin 6. Determined by X-ray diffraction at 2.0 Å resolution. Released 7 Apr 2021.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,327
Mol. weight: 20.82 kDa
Released: 7 Apr 2021

Explore 7NXZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7NXZ contains 8 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain AAA: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	17-19	3
α-helix	20-45	26
α-helix	68-70	3
α-helix	79-103	25
α-helix	108-128	21
α-helix	137-139	3
α-helix	140-151	12
α-helix	155-182	28

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-6	AAA	protein	183	Homo sapiens	P05231 (AlphaFold model)

Sequence of entity 1 (AAA), FASTA

>7NXZ_1 Interleukin-6 (chains AAA)
VPPGEDSKDVAAPHRQPLTSSERIDKQIRYILDGISALRKETCNKSNLCESSKEALAENN
LNLPKMAEKDGCFQSGFNEETCLVKIITGLLEFEVYLEYLQNRFESSEEQARAVQMSTKV
LIQFLQKKAKNLDAITTPDPTTNASLLTKLQAQNQWLQDMTTHLILRSFKEFLQSSLRAL
RQM

Primary citation

Natural Glycoforms of Human Interleukin 6 Show Atypical Plasma Clearance. Reif, A., Lam, K., Weidler, S. et al. Angew Chem Int Ed Engl (2021) 60:13380-13387. DOI 10.1002/anie.202101496 · PubMed

Other PDB entries of the same protein (UniProt P05231 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1ALU 1.9 Å, Human interleukin-6
4CNI 2.2 Å, Crystal structure of the Fab portion of Olokizumab in complex with IL- 6
4J4L 2.3 Å, Modular evolution and design of the protein binding interface
4NI7 2.4 Å, Crystal structure of human interleukin 6 in complex with a modified nucleotide aptamer…
4O9H 2.42 Å, Structure of Interleukin-6 in complex with a Camelid Fab fragment
8YWQ 2.51 Å, Crystal structure of the Fab fragment of the anti-IL-6 antibody I9H in complex with a…
4NI9 2.55 Å, Crystal structure of human interleukin 6 in complex with a modified nucleotide aptamer…
5FUC 2.7 Å, Biophysical and cellular characterisation of a junctional epitope antibody that locks…
4ZS7 2.93 Å, Structural mimicry of receptor interaction by antagonistic IL-6 antibodies
8YWR 2.93 Å, Crystal structure of the Fab fragment of the anti-IL-6 antibody 68F2 in complex with a…
8QY5 3.1 Å, Structure of interleukin 6.
8QY6 3.16 Å, Structure of interleukin 6 (gp130 P496L mutant).

Browse structure collections

About this viewer

MolViewer shows 7NXZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.