1ALY: Human CD40 ligand

Crystal structure of human CD40 ligand. Determined by X-ray diffraction at 2.0 Å resolution. Released 17 Sept 1997.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,177
Mol. weight: 15.81 kDa
Released: 17 Sept 1997

Explore 1ALY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ALY contains 2 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	123-128	6	1
β-strand	137	1	2
α-helix	138-139	2
β-strand	140-141	2	1
β-strand	147-148	2	1
β-strand	153-156	4	2
β-strand	160-163	4	2
β-strand	167-179	13	1
β-strand	188-195	8	2
β-strand	203-211	9	2
β-strand	219-231	13	1
β-strand	232	1	3
β-strand	235	1	3
β-strand	237-241	5	2
α-helix	244-246	3
β-strand	247	1	1
β-strand	255-260	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CD40 ligand	A	protein	146	Homo sapiens	P29965 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1ALY_1 CD40 LIGAND (chains A)
GDQNPQIAAHVISEASSKTTSVLQWAEKGYYTMSNNLVTLENGKQLTVKRQGLYYIYAQV
TFCSNREASSQAPFIASLCLKSPGRFERILLRAANTHSSAKPCGQQSIHLGGVFELQPGA
SVFVNVTDPSQVSHGTGFTSFGLLKL

Primary citation

2 A crystal structure of an extracellular fragment of human CD40 ligand. Karpusas, M., Hsu, Y.M., Wang, J.H. et al. Structure (1995) 3:1031-1039. DOI 10.1016/S0969-2126(01)00239-8 · PubMed

Other PDB entries of the same protein (UniProt P29965 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6W9G 1.82 Å, Crystal Structure of the Fab fragment of humanized 5c8 antibody containing the…
7SGM 2.0 Å, Crystal structure of a Fab variant containing a fluorescent noncanonical amino acid with…
3LKJ 2.5 Å, Small Molecule Inhibition of the TNF Family Cyokine CD40 Ligand Through a Subunit…
6BRB 2.82 Å, Novel non-antibody protein scaffold targeting CD40L
1I9R 3.1 Å, Structure of CD40L in complex with the FAB fragment of humanized 5C8 antibody
9I5N 3.4 Å, Single particle cryo electron microscopy of a Fab fragment bound to recombinant human…
3QD6 3.5 Å, Crystal structure of the CD40 and CD154 (CD40L) complex

Browse structure collections

About this viewer

MolViewer shows 1ALY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.