Structure of the chromatin binding (CHROMO) domain from mouse modifier protein 1, NMR, 26 structures. Determined by solution NMR. Released 22 Jul 1998.
Explore 1AP0 in 3D Show helices and sheets RCSB PDB PDBe
1AP0 contains 1 α-helix and 3 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22-31 | 10 | 1 |
| β-strand | 36-43 | 8 | 1 |
| β-strand | 51-54 | 4 | 1 |
| α-helix | 61-67 | 7 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Modifier protein 1 | A | protein | 73 | Mus musculus | P83917 (AlphaFold model) |
>1AP0_1 MODIFIER PROTEIN 1 (chains A) HMVEEVLEEEEEEYVVEKVLDRRVVKGKVEYLLKWKGFSDEDNTWEPEENLDCPDLIAEF LQSQKTAHETDKS
Structure of the chromatin binding (chromo) domain from mouse modifier protein 1. Ball, L.J., Murzina, N.V., Broadhurst, R.W. et al. EMBO J (1997) 16:2473-2481. DOI 10.1093/emboj/16.9.2473 · PubMed
Other PDB entries of the same protein (UniProt P83917 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1AP0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.