1ATZ: Human von willebrand factor A3 domain

Human von willebrand factor A3 domain. Determined by X-ray diffraction at 1.8 Å resolution. Released 25 Feb 1998.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,147
Mol. weight: 40.3 kDa
Released: 25 Feb 1998

Explore 1ATZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1ATZ contains 16 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	927-934	8	1
α-helix	941-957	17
β-strand	960	1	1
β-strand	965-972	8	1
β-strand	976-980	5	1
α-helix	988-996	9
α-helix	1007-1019	13
β-strand	1030-1037	8	1
α-helix	1046-1054	9
β-strand	1057-1064	8	1
α-helix	1070-1076	7
α-helix	1078-1084	7
β-strand	1086-1088	3	1
α-helix	1093-1099	7
α-helix	1103-1107	5

Chain B: 8 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	927-934	8	2
α-helix	941-957	17
β-strand	960	1	2
β-strand	965-972	8	2
β-strand	976-980	5	2
α-helix	988-996	9
α-helix	1007-1019	13
β-strand	1030-1037	8	2
α-helix	1046-1054	9
β-strand	1057-1064	8	2
α-helix	1070-1076	7
α-helix	1078-1083	6
β-strand	1086-1088	3	2
α-helix	1093-1099	7
α-helix	1103-1109	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Von willebrand factor	A, B	protein	189	Homo sapiens	P04275 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1ATZ_1 VON WILLEBRAND FACTOR (chains A, B)
DCSQPLDVILLLDGSSSFPASYFDEMKSFAKAFISKANIGPRLTQVSVLQYGSITTIDVP
WNVVPEKAHLLSLVDVMQREGGPSQIGDALGFAVRYLTSEMHGARPGASKAVVILVTDVS
VDSVDAAADAARSNRVTVFPIGIGDRYDAAQLRILAGPAGDSNVVKLQRIEDLPTMVTLG
NSFLHKLCS

Primary citation

Crystal structure of the A3 domain of human von Willebrand factor: implications for collagen binding. Huizinga, E.G., Martijn van der Plas, R., Kroon, J. et al. Structure (1997) 5:1147-1156. DOI 10.1016/S0969-2126(97)00266-9 · PubMed

Other PDB entries of the same protein (UniProt P04275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BV8 1.59 Å, G1324S mutation in von Willebrand Factor A1 domain
7EOW 1.6 Å, High-resolution structure of vWF A1 domain in complex with caplacizumab, the first…
3ZQK 1.7 Å, Von Willebrand Factor A2 domain with calcium
1IJB 1.8 Å, The von Willebrand Factor mutant (I546V) A1 domain
2ADF 1.9 Å, Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody…
3GXB 1.9 Å, Crystal structure of VWF A2 domain
3PPV 1.9 Å, Crystal structure of an engineered VWF A2 domain (N1493C and C1670S)
3PPW 1.9 Å, Crystal structure of the D1596A mutant of an engineered VWF A2 domain (N1493C and C1670S)
3PPX 1.91 Å, Crystal structure of the N1602A mutant of an engineered VWF A2 domain (N1493C and C1670S)
1FNS 2.0 Å, Crystal structure of the von willebrand factor (VWF) A1 domain I546V mutant in complex…
3PPY 2.0 Å, Crystal structure of the D1596A/N1602A double mutant of an engineered VWF A2 domain…
1FE8 2.03 Å, Crystal structure of the von willebrand factor A3 domain in complex with a FAB fragment…

Browse structure collections

About this viewer

MolViewer shows 1ATZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.