7EOW: VWF A1 domain

High-resolution structure of vWF A1 domain in complex with caplacizumab, the first nanobody-based medicine. Determined by X-ray diffraction at 1.6 Å resolution. Released 7 Jul 2021.

Method: X-ray diffraction
Resolution: 1.6 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,980
Mol. weight: 41.57 kDa
Released: 7 Jul 2021

Explore 7EOW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7EOW contains 11 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	34	1	1
β-strand	36	1	2
β-strand	40-47	8	3
β-strand	49	1	4
α-helix	54-69	16
β-strand	71	1	2
β-strand	73	1	3
β-strand	78-86	9	3
β-strand	88-93	6	3
α-helix	101-109	9
α-helix	111-113	3
β-strand	116	1	4
α-helix	121-127	7
α-helix	128-132	5
β-strand	142-149	8	3
α-helix	155-157	3
α-helix	161-170	10
β-strand	173-180	8	3
α-helix	186-195	10
β-strand	202-204	3	3
α-helix	208-223	16

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	5
β-strand	11-13	3	6
β-strand	19-26	8	5
β-strand	35-40	6	6
β-strand	46-52	7	6
β-strand	59-60	2	6
β-strand	69-74	6	5
β-strand	79-84	6	5
α-helix	89-91	3
β-strand	93-100	8	6
β-strand	106	1	1
α-helix	113-115	3
β-strand	116-119	4	6
β-strand	123-127	5	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
von Willebrand factor	A	protein	232	Homo sapiens	P04275 (AlphaFold model)
caplacizumab	B	protein	137	Homo sapiens

Sequence of entity 1 (A), FASTA

>7EOW_1 von Willebrand factor (chains A)
MGSSHHHHHHSSGENLYFQSGSHMDISEPPLHDFYCSRLLDLVFLLDGSSRLSEAEFEVL
KAFVVDMMERLRISQKWVRVAVVEYHDGSHAYIGLKDRKRPSELRRIASQVKYAGSQVAS
TSEVLKYTLFQIFSKIDRPEASRITLLLMASQEPQRMSRNFVRYVQGLKKKKVIVIPVGI
GPHANLKQIRLIEKQAPENKAFVLSSVDELEQQRDEIVSYLCDLAPEAPPPT

Sequence of entity 2 (B), FASTA

>7EOW_2 caplacizumab (chains B)
MEVQLVESGGGLVQPGGSLRLSCAASGRTFSYNPMGWFRQAPGKGRELVAAISRTGGSTY
YPDSVEGRFTISRDNAKRMVYLQMNSLRAEDTAVYYCAAAGVRAEDGRVRTLPSEYTFWG
QGTQVTVSSLEHHHHHH

Primary citation

High-resolution structure of the vWF A1 domain in complex with caplacizumab, the first nanobody-based medicine for treating acquired TTP. Lee, H.T., Park, U.B., Jeong, T.J. et al. Biochem Biophys Res Commun (2021) 567:49-55. DOI 10.1016/j.bbrc.2021.06.030 · PubMed

Other PDB entries of the same protein (UniProt P04275 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5BV8 1.59 Å, G1324S mutation in von Willebrand Factor A1 domain
3ZQK 1.7 Å, Von Willebrand Factor A2 domain with calcium
1ATZ 1.8 Å, Human von willebrand factor A3 domain
1IJB 1.8 Å, The von Willebrand Factor mutant (I546V) A1 domain
2ADF 1.9 Å, Crystal Structure and Paratope Determination of 82D6A3, an Antithrombotic Antibody…
3GXB 1.9 Å, Crystal structure of VWF A2 domain
3PPV 1.9 Å, Crystal structure of an engineered VWF A2 domain (N1493C and C1670S)
3PPW 1.9 Å, Crystal structure of the D1596A mutant of an engineered VWF A2 domain (N1493C and C1670S)
3PPX 1.91 Å, Crystal structure of the N1602A mutant of an engineered VWF A2 domain (N1493C and C1670S)
1FNS 2.0 Å, Crystal structure of the von willebrand factor (VWF) A1 domain I546V mutant in complex…
3PPY 2.0 Å, Crystal structure of the D1596A/N1602A double mutant of an engineered VWF A2 domain…
1FE8 2.03 Å, Crystal structure of the von willebrand factor A3 domain in complex with a FAB fragment…

Browse structure collections

About this viewer

MolViewer shows 7EOW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.