1AX8: Human obesity protein, leptin

Human obesity protein, leptin. Determined by X-ray diffraction at 2.4 Å resolution. Released 25 Nov 1998.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,074
Mol. weight: 15.98 kDa
Released: 25 Nov 1998

Explore 1AX8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1AX8 contains 9 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	4-23	20
α-helix	42-44	3
α-helix	51-66	16
α-helix	71-93	23
α-helix	99-102	4
α-helix	107-110	4
α-helix	111-114	4
β-strand	116	1	1
β-strand	119	1	1
α-helix	121-139	19
α-helix	140-142	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Obesity protein	A	protein	146	Homo sapiens	P41159 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1AX8_1 OBESITY PROTEIN (chains A)
VPIQKVQDDTKTLIKTIVTRINDISHTQSVSSKQKVTGLDFIPGLHPILTLSKMDQTLAV
YQQILTSMPSRNVIQISNDLENLRDLLHVLAFSKSCHLPEASGLETLDSLGGVLEASGYS
TEVVALSRLQGSLQDMLWQLDLSPGC

Primary citation

Crystal structure of the obese protein leptin-E100. Zhang, F., Basinski, M.B., Beals, J.M. et al. Nature (1997) 387:206-209. DOI 10.1038/387206a0 · PubMed

Other PDB entries of the same protein (UniProt P41159 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9PUO 3.1 Å, Neutralizing monoclonal antibody Fab fragment bound to leptin
8X85 3.58 Å, Structure of leptin-LepR dimer
7Z3Q 3.62 Å, Crystal structure of the human leptin:LepR-CRH2 encounter complex to 3.6 A resolution.
8X81 3.77 Å, Structure of leptin-LepR trimer with a large gap
8X80 3.88 Å, Structure of leptin-LepR trimer with a small gap
8AVE 5.62 Å, Human leptin in complex with the human LEP-R ectodomain fused to a C-terminal trimeric…
8AVF 6.45 Å, Human leptin in complex with the human LEP-R ectodomain fused to a C-terminal trimeric…
8AVO 6.84 Å, Human leptin in complex with the human LEP-R ectodomain fused to a C-terminal trimeric…
8K6Z NMR structure of human leptin

Browse more

1AX8 is part of these collections:

Insulin and hormones

About this viewer

MolViewer shows 1AX8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.