Inhibitor-free catalytic fragment of human fibroblast collagenase, NMR, 30 structures. Determined by solution NMR. Released 25 Feb 1998.
Explore 1AYK in 3D Show helices and sheets RCSB PDB PDBe
1AYK contains 4 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 13-18 | 6 | 1 |
| α-helix | 27-43 | 17 | |
| β-strand | 48-51 | 4 | 1 |
| β-strand | 59-64 | 6 | 1 |
| β-strand | 82-84 | 3 | 1 |
| β-strand | 95-98 | 4 | 1 |
| α-helix | 102-103 | 2 | |
| β-strand | 104 | 1 | 2 |
| β-strand | 111 | 1 | 2 |
| α-helix | 112-123 | 12 | |
| α-helix | 150-159 | 10 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Collagenase | A | protein | 169 | Homo sapiens | P03956 (AlphaFold model) |
>1AYK_1 COLLAGENASE (chains A) VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIM ISFVRGDHRDNSPFDGPGGNLAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHEL GHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIYGRSQNPVQP
High-resolution solution structure of the inhibitor-free catalytic fragment of human fibroblast collagenase determined by multidimensional NMR. Moy, F.J., Chanda, P.K., Cosmi, S. et al. Biochemistry (1998) 37:1495-1504. DOI 10.1021/bi972181w · PubMed
Other PDB entries of the same protein (UniProt P03956 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1AYK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.