1B0W: Bence-jones kappa I protein bre

Structural comparison of amyloidogenic light chain dimer in two crystal forms with nonamyloidogenic counterparts. Determined by X-ray diffraction at 1.8 Å resolution. Released 16 Nov 1998.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,624
Mol. weight: 35.84 kDa
Released: 16 Nov 1998

Explore 1B0W in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B0W contains 9 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	98	1	2
β-strand	102-106	5	2

Chains B and C: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	3
β-strand	10-13	4	4
β-strand	19-25	7	3
β-strand	33-38	6	4
β-strand	45-49	5	4
β-strand	53-54	2	4
α-helix	55	1
β-strand	62-67	6	3
β-strand	70-75	6	3
α-helix	80-82	3
β-strand	84-90	7	4
α-helix	96	1
β-strand	97-98	2	4
β-strand	102-106	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bence-jones kappa I protein bre	A, B, C	protein	108	Homo sapiens	P01594 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1B0W_1 BENCE-JONES KAPPA I PROTEIN BRE (chains A, B, C)
DIQMTQSPSSLSASVGDRVTITCQASQDISDYLIWYQQKLGKAPNLLIYDASTLETGVPS
RFSGSGSGTEYTFTISSLQPEDIATYYCQQYDDLPYTFGQGTKVEIKR

Primary citation

Tertiary structures of amyloidogenic and non-amyloidogenic transthyretin variants: new model for amyloid fibril formation. Schormann, N., Murrell, J.R., Benson, M.D. Amyloid (1998) 5:175-187. PubMed

Other PDB entries of the same protein (UniProt P01594 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Q20 1.3 Å, Structure of the germline Vk1 O18/O8 light chain variable domain homodimer
3CDC 1.53 Å, kI O18/O8 N34I/Y87H immunoglobulin light chain variable domain
3CDF 1.53 Å, kI O18/O8 Y87H immunoglobulin light chain variable domain
1QP1 2.06 Å, Kappa variable light chain
1JV5 2.2 Å, Anti-blood group A Fv
3CDY 2.43 Å, AL-09 H87Y, immunoglobulin light chain variable domain
7CZQ 2.8 Å, S protein of SARS-CoV-2 in complex bound with P2B-1A10
4K07 2.83 Å, Crystal structure of the amyloid-forming immunoglobulin AL-103 cis-proline 95 mutant
7CZV 3.3 Å, S protein of SARS-CoV-2 in complex bound with P5A-1B6_3B
7CZU 3.4 Å, S protein of SARS-CoV-2 in complex bound with P5A-1B6_2B

Browse structure collections

About this viewer

MolViewer shows 1B0W directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.