1QP1: Kappa variable light chain

Kappa variable light chain. Determined by X-ray diffraction at 2.06 Å resolution. Released 17 Jun 1999.

Method: X-ray diffraction
Resolution: 2.06 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,678
Mol. weight: 35.36 kDa
Released: 17 Jun 1999

Explore 1QP1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QP1 contains 10 α-helices and 33 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and C: 3 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	3
β-strand	10-13	4	2
β-strand	19-25	7	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	3
β-strand	70-75	6	3
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96	1
β-strand	97-98	2	2
β-strand	102-106	5	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bence-jones kappa I antibody bre (light chain)	A, B, C	protein	107	Homo sapiens	P01594 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1QP1_1 BENCE-JONES KAPPA I ANTIBODY BRE (LIGHT CHAIN) (chains A, B, C)
DIQMTQSPSSLSASVGDRVTITCQASQDISDYLIWYQQKLGKAPNLLIYDASTLETGVPS
RFSGSGSGTEYTFTISSLQPEDIATYYCQQYDDLPYTFGQGTKVEIK

Primary citation

Molecular structure of the amyloid-forming protein kappa I Bre. Steinrauf, L.K., Chiang, M.Y., Shiuan, D. J Biochem (1999) 125:422-429. PubMed

Other PDB entries of the same protein (UniProt P01594 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2Q20 1.3 Å, Structure of the germline Vk1 O18/O8 light chain variable domain homodimer
3CDC 1.53 Å, kI O18/O8 N34I/Y87H immunoglobulin light chain variable domain
3CDF 1.53 Å, kI O18/O8 Y87H immunoglobulin light chain variable domain
1B0W 1.8 Å, Structural comparison of amyloidogenic light chain dimer in two crystal forms with…
1JV5 2.2 Å, Anti-blood group A Fv
3CDY 2.43 Å, AL-09 H87Y, immunoglobulin light chain variable domain
7CZQ 2.8 Å, S protein of SARS-CoV-2 in complex bound with P2B-1A10
4K07 2.83 Å, Crystal structure of the amyloid-forming immunoglobulin AL-103 cis-proline 95 mutant
7CZV 3.3 Å, S protein of SARS-CoV-2 in complex bound with P5A-1B6_3B
7CZU 3.4 Å, S protein of SARS-CoV-2 in complex bound with P5A-1B6_2B

Browse structure collections

About this viewer

MolViewer shows 1QP1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.