1B2S: Protein

Structural response to mutation at a protein-protein interface. Determined by X-ray diffraction at 1.82 Å resolution. Released 8 Dec 1998.

Method: X-ray diffraction
Resolution: 1.82 Å
Organism: Bacillus amyloliquefaciens
Chains: 6
Atoms: 5,378
Mol. weight: 68.18 kDa
Released: 8 Dec 1998

Explore 1B2S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B2S contains 32 α-helices and 30 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B and C: 5 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	7-17	11
β-strand	24-25	2	1
α-helix	27-32	6
α-helix	37-39	3
α-helix	42-45	4
β-strand	50-51	2	1
β-strand	52-56	5	2
α-helix	64-65	2
β-strand	71-75	5	2
β-strand	87-91	5	2
β-strand	96-99	4	2
β-strand	107-108	2	2

Chain D: 5 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	7
α-helix	8-10	3
α-helix	14-24	11
α-helix	35-44	10
β-strand	50-55	6	7
α-helix	57-62	6
α-helix	67-80	14
β-strand	85-88	4	7

Chain E: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
α-helix	2-3	2
β-strand	4-7	4	8
α-helix	8-10	3
α-helix	14-24	11
α-helix	35-44	10
β-strand	50-55	6	8
α-helix	57-62	6
α-helix	67-80	14
β-strand	85-88	4	8

Chain F: 6 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	9
α-helix	8-10	3
α-helix	14-24	11
α-helix	35-44	10
α-helix	46-47	2
β-strand	50-55	6	9
α-helix	57-62	6
α-helix	67-80	14
β-strand	85-88	4	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (barnase)	A, B, C	protein	110	Bacillus amyloliquefaciens	P00648 (AlphaFold model)
Protein (barstar)	D, E, F	protein	90	Bacillus amyloliquefaciens	P11540 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1B2S_1 PROTEIN (BARNASE) (chains A, B, C)
AQVINTFDGVADYLQTYHKLPDNYITASEAQALGWVASKGNLADVAPGKSIGGDIFSNRE
GKLPGKSGRTWREADINYTSGFRNSDRILYSSDWLIYKTTDHYQTFTKIR

Sequence of entity 2 (D, E, F), FASTA

>1B2S_2 PROTEIN (BARSTAR) (chains D, E, F)
MKKAVINGEQIRSISDLHQTLKKELALPEYYGENLDALWDCLAGWVEYPLVLEWRQFEQS
KQLTENGAESVLQVFREAKAEGCDITIILS

Primary citation

Structural response to mutation at a protein-protein interface. Vaughan, C.K., Buckle, A.M., Fersht, A.R. J Mol Biol (1999) 286:1487-1506. DOI 10.1006/jmbi.1998.2559 · PubMed

Other PDB entries of the same protein (UniProt P00648 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6PQK 1.2 Å, Cryogenic crystal structure of barnase A43C/S80C bound to barstar C40A/S59C/A67C/C82A
2C4B 1.3 Å, Inhibitor cystine knot protein McoEeTI fused to the catalytically inactive barnase…
1A2P 1.5 Å, Barnase wildtype structure at 1.5 Å resolution
2ZA4 1.58 Å, Crystal Structural Analysis of Barnase-barstar Complex
1B20 1.7 Å, Deletion of a buried salt-bridge in barnase
1BRN 1.76 Å, Subsite binding in an RNase: structure of a barnase-tetranucleotide complex at 1.76 Å…
1B2X 1.8 Å, Barnase wildtype structure at PH 7.5 from a cryo_cooled crystal at 100K
1BRI 1.9 Å, Barnase mutant with ile 76 replaced by ala
1RNB 1.9 Å, Crystal structure of a barnase-d(*gp*c) complex at 1.9 Å resolution
1X1Y 1.9 Å, Water-mediate interaction at aprotein-protein interface
3KCH 1.94 Å, Baranase crosslinked by glutaraldehyde
2F5M 1.95 Å, Cross-linked barnase soaked in bromo-ethanol

Browse structure collections

About this viewer

MolViewer shows 1B2S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.