1B44: Protein

Name: PDB 1B44: Crystal structure of the B subunit of heat-labile enterotoxin from E. Coli carrying a peptide with anti-hsv activity
Published: 1999-01-13
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: toxin

Crystal structure of the B subunit of heat-labile enterotoxin from E. Coli carrying a peptide with anti-hsv activity. Determined by X-ray diffraction at 3.3 Å resolution. Released 13 Jan 1999.

Method: X-ray diffraction
Resolution: 3.3 Å
Organism: Escherichia coli
Chains: 5
Atoms: 4,186
Mol. weight: 71.47 kDa
Released: 13 Jan 1999

Explore 1B44 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B44 contains 16 α-helices and 32 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain D: 3 helices, 8 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-30	5	1
β-strand	32	1	2
β-strand	35	1	2
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	61-77	17
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Chain E: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-30	5	1
β-strand	37-41	5	1
β-strand	47-50	4	1
α-helix	59-77	19
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Chain F: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-30	5	1
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	61-77	17
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Chain G: 3 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-32	7	1
β-strand	35-41	7	1
β-strand	47-50	4	1
α-helix	61-77	17
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Chain H: 4 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-9	5
β-strand	15-23	9	1
β-strand	26-30	5	1
β-strand	38-41	4	1
β-strand	47-50	4	1
α-helix	59-61	3
α-helix	62-77	16
α-helix	80	1
β-strand	81-88	8	1
β-strand	94-102	9	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (B-pol subunit of heat-labile enterotoxin)	D, E, F, G, H	protein	129	Escherichia coli	P0CK94 (AlphaFold model)

Sequence of entity 1 (D, E, F, G, H), FASTA

>1B44_1 PROTEIN (B-POL SUBUNIT OF HEAT-LABILE ENTEROTOXIN) (chains D, E, F, G, H)
APQSITELCSEYHNTQIYTINDKILSYTESMAGKREMVIITFKSGATFQVEVPGSQHIDS
QKKAIERMKDTLRITYLTETKIDKLCVWNNKTPNSIAAISMEKLAGFGAVGAGATAEETR
MLHAFDTLA

Primary citation

Crystal structure of the B subunit of Escherichia coli heat-labile enterotoxin carrying peptides with anti-herpes simplex virus type 1 activity. Matkovic-Calogovic, D., Loregian, A., D'Acunto, M.R. et al. J Biol Chem (1999) 274:8764-8769. PubMed

Other PDB entries of the same protein (UniProt P0CK94 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3EFX 1.94 Å, Novel binding site identified in a hybrid between cholera toxin and heat-labile…
2O2L 2.53 Å, Crystal structure of human heat-labile enterotoxin in complex with a blood group A…
1LTR 3.04 Å, Crystal structure of the B subunit of human heat-labile enterotoxin from E. Coli…

Browse structure collections

About this viewer

MolViewer shows 1B44 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.