1B9Y: Protein

Structural analysis of phosducin and its phosphorylation-regulated interaction with transducin beta-gamma. Determined by X-ray diffraction at 3.0 Å resolution. Released 23 Feb 1999.

Method: X-ray diffraction
Resolution: 3.0 Å
Organisms: Bos taurus, Rattus norvegicus
Chains: 3
Atoms: 4,526
Mol. weight: 74.58 kDa
Ligands: GD
Released: 23 Feb 1999

Explore 1B9Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1B9Y contains 16 α-helices and 34 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 29 β-strands

Element	Residues	Length	Sheet
α-helix	7-23	17
α-helix	30-33	4
α-helix	38-42	5
β-strand	43	1	1
β-strand	47-51	5	2
β-strand	58-63	6	3
β-strand	69-74	6	3
β-strand	78-83	6	3
β-strand	88-94	7	3
β-strand	100-105	6	4
β-strand	111-116	6	4
β-strand	121-125	5	4
β-strand	137-139	3	4
β-strand	146-153	8	5
β-strand	156-161	6	5
β-strand	166-170	5	5
β-strand	175-180	6	5
β-strand	187-192	6	6
β-strand	198-203	6	6
β-strand	207-212	6	6
β-strand	218-223	6	6
β-strand	229-234	6	7
β-strand	240-245	6	7
β-strand	250-254	5	7
β-strand	259-264	6	7
α-helix	272	1
β-strand	273-278	6	1
β-strand	284-289	6	1
β-strand	294-298	5	1
β-strand	304-308	5	1
β-strand	317-320	4	2
β-strand	327-330	4	2
β-strand	336-339	4	2

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	511-526	16
α-helix	533-548	16
α-helix	552-555	4
α-helix	559-561	3

Chain C: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	21-36	16
α-helix	89-105	17
β-strand	114-116	3	8
α-helix	117	1
α-helix	120-128	9
β-strand	135-141	7	8
α-helix	148-161	14
β-strand	166-171	6	8
α-helix	172-175	4
β-strand	188-193	6	8
β-strand	196-201	6	8
α-helix	204-207	4
α-helix	214-222	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (transducin)	A	protein	340	Bos taurus	P62871 (AlphaFold model)
Protein (transducin)	B	protein	68	Bos taurus	P02698 (AlphaFold model)
Protein (phosducin)	C	protein	246	Rattus norvegicus	P20942 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1B9Y_1 PROTEIN (TRANSDUCIN) (chains A)
MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYA
MHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI
CSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF
TGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA
FATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDAL
KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN

Sequence of entity 2 (B), FASTA

>1B9Y_2 PROTEIN (TRANSDUCIN) (chains B)
MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEFRDYVEERSGEDPLVKGIPED
KNPFKELK

Sequence of entity 3 (C), FASTA

>1B9Y_3 PROTEIN (PHOSDUCIN) (chains C)
MEEAASQSLEEDFEGQATHTGPKGVINDWRKFKLESEDGDSIPPSKKEILRQMSSPQSRD
DKDSKERMSRKMSIQEYELIHQDKEDEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETG
EQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDR
FSSDVLPTLLVYKGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPEREIHDLGQTNT
EDEDIE

Ligands and cofactors

ID	Name	Formula	Copies
GD	Gadolinium atom	Gd	6

Primary citation

A molecular mechanism for the phosphorylation-dependent regulation of heterotrimeric G proteins by phosducin. Gaudet, R., Savage, J.R., McLaughlin, J.N. et al. Mol Cell (1999) 3:649-660. DOI 10.1016/S1097-2765(00)80358-5 · PubMed

Other PDB entries of the same protein (UniProt P62871 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5KDO 1.9 Å, Heterotrimeric complex of the 4 alanine insertion variant of the Gi alpha1 subunit and…
1GOT 2.0 Å, Heterotrimeric complex of a gt-alpha/gi-alpha chimera and the gt-beta-gamma subunits
3V5W 2.07 Å, Human G Protein-Coupled Receptor Kinase 2 in Complex with Soluble Gbetagamma Subunits…
1TBG 2.1 Å, Beta-gamma dimer of the heterotrimeric G-protein transducin
1GP2 2.3 Å, G protein heterotrimer GI_ALPHA_1 BETA_1 GAMMA_2 with GDP bound
5WG4 2.31 Å, Human GRK2 in complex with Gbetagamma subunits and CCG257284
6B20 2.34 Å, Crystal structure of a complex between G protein beta gamma dimer and an inhibitory…
1GG2 2.4 Å, G protein heterotrimer mutant GI_ALPHA_1(G203A) BETA_1 GAMMA_2 with GDP bound
2TRC 2.4 Å, Phosducin/transducin beta-gamma complex
4MK0 2.4 Å, Crystal structure of G protein-coupled receptor kinase 2 in complex with a a rationally…
6U7C 2.44 Å, Human GRK2 in complex with Gbetagamma subunits and CCG258747
3PVU 2.48 Å, Bovine GRK2 in complex with Gbetagamma subunits and a selective kinase inhibitor (CMPD101)

Browse structure collections

About this viewer

MolViewer shows 1B9Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.