Structural analysis of phosducin and its phosphorylation-regulated interaction with transducin beta-gamma. Determined by X-ray diffraction at 3.0 Å resolution. Released 23 Feb 1999.
Explore 1B9Y in 3D Show helices and sheets RCSB PDB PDBe
1B9Y contains 16 α-helices and 34 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-23 | 17 | |
| α-helix | 30-33 | 4 | |
| α-helix | 38-42 | 5 | |
| β-strand | 43 | 1 | 1 |
| β-strand | 47-51 | 5 | 2 |
| β-strand | 58-63 | 6 | 3 |
| β-strand | 69-74 | 6 | 3 |
| β-strand | 78-83 | 6 | 3 |
| β-strand | 88-94 | 7 | 3 |
| β-strand | 100-105 | 6 | 4 |
| β-strand | 111-116 | 6 | 4 |
| β-strand | 121-125 | 5 | 4 |
| β-strand | 137-139 | 3 | 4 |
| β-strand | 146-153 | 8 | 5 |
| β-strand | 156-161 | 6 | 5 |
| β-strand | 166-170 | 5 | 5 |
| β-strand | 175-180 | 6 | 5 |
| β-strand | 187-192 | 6 | 6 |
| β-strand | 198-203 | 6 | 6 |
| β-strand | 207-212 | 6 | 6 |
| β-strand | 218-223 | 6 | 6 |
| β-strand | 229-234 | 6 | 7 |
| β-strand | 240-245 | 6 | 7 |
| β-strand | 250-254 | 5 | 7 |
| β-strand | 259-264 | 6 | 7 |
| α-helix | 272 | 1 | |
| β-strand | 273-278 | 6 | 1 |
| β-strand | 284-289 | 6 | 1 |
| β-strand | 294-298 | 5 | 1 |
| β-strand | 304-308 | 5 | 1 |
| β-strand | 317-320 | 4 | 2 |
| β-strand | 327-330 | 4 | 2 |
| β-strand | 336-339 | 4 | 2 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 511-526 | 16 | |
| α-helix | 533-548 | 16 | |
| α-helix | 552-555 | 4 | |
| α-helix | 559-561 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 21-36 | 16 | |
| α-helix | 89-105 | 17 | |
| β-strand | 114-116 | 3 | 8 |
| α-helix | 117 | 1 | |
| α-helix | 120-128 | 9 | |
| β-strand | 135-141 | 7 | 8 |
| α-helix | 148-161 | 14 | |
| β-strand | 166-171 | 6 | 8 |
| α-helix | 172-175 | 4 | |
| β-strand | 188-193 | 6 | 8 |
| β-strand | 196-201 | 6 | 8 |
| α-helix | 204-207 | 4 | |
| α-helix | 214-222 | 9 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (transducin) | A | protein | 340 | Bos taurus | P62871 (AlphaFold model) |
| Protein (transducin) | B | protein | 68 | Bos taurus | P02698 (AlphaFold model) |
| Protein (phosducin) | C | protein | 246 | Rattus norvegicus | P20942 (AlphaFold model) |
>1B9Y_1 PROTEIN (TRANSDUCIN) (chains A) MSELDQLRQEAEQLKNQIRDARKACADATLSQITNNIDPVGRIQMRTRRTLRGHLAKIYA MHWGTDSRLLLSASQDGKLIIWDSYTTNKVHAIPLRSSWVMTCAYAPSGNYVACGGLDNI CSIYNLKTREGNVRVSRELAGHTGYLSCCRFLDDNQIVTSSGDTTCALWDIETGQQTTTF TGHTGDVMSLSLAPDTRLFVSGACDASAKLWDVREGMCRQTFTGHESDINAICFFPNGNA FATGSDDATCRLFDLRADQELMTYSHDNIICGITSVSFSKSGRLLLAGYDDFNCNVWDAL KADRAGVLAGHDNRVSCLGVTDDGMAVATGSWDSFLKIWN
>1B9Y_2 PROTEIN (TRANSDUCIN) (chains B) MPVINIEDLTEKDKLKMEVDQLKKEVTLERMLVSKCCEEFRDYVEERSGEDPLVKGIPED KNPFKELK
>1B9Y_3 PROTEIN (PHOSDUCIN) (chains C) MEEAASQSLEEDFEGQATHTGPKGVINDWRKFKLESEDGDSIPPSKKEILRQMSSPQSRD DKDSKERMSRKMSIQEYELIHQDKEDEGCLRKYRRQCMQDMHQKLSFGPRYGFVYELETG EQFLETIEKEQKVTTIVVNIYEDGVRGCDALNSSLECLAAEYPMVKFCKIRASNTGAGDR FSSDVLPTLLVYKGGELISNFISVAEQFAEDFFAADVESFLNEYGLLPEREIHDLGQTNT EDEDIE
| ID | Name | Formula | Copies |
|---|---|---|---|
| GD | Gadolinium atom | Gd | 6 |
A molecular mechanism for the phosphorylation-dependent regulation of heterotrimeric G proteins by phosducin. Gaudet, R., Savage, J.R., McLaughlin, J.N. et al. Mol Cell (1999) 3:649-660. DOI 10.1016/S1097-2765(00)80358-5 · PubMed
Other PDB entries of the same protein (UniProt P62871 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1B9Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.