Firefly luciferase in complex with bromoform. Determined by X-ray diffraction at 2.2 Å resolution. Released 11 Nov 1998.
Explore 1BA3 in 3D Show helices and sheets RCSB PDB PDBe
1BA3 contains 25 α-helices and 35 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-9 | 2 | 1 |
| α-helix | 16-18 | 3 | |
| α-helix | 22-34 | 13 | |
| β-strand | 40-44 | 5 | 2 |
| β-strand | 50-52 | 3 | 2 |
| α-helix | 53-70 | 18 | |
| β-strand | 77-81 | 5 | 3 |
| α-helix | 89-98 | 10 | |
| α-helix | 100 | 1 | |
| β-strand | 101-104 | 4 | 3 |
| α-helix | 105-106 | 2 | |
| α-helix | 111-121 | 11 | |
| β-strand | 125-128 | 4 | 3 |
| α-helix | 130-132 | 3 | |
| α-helix | 133-142 | 10 | |
| β-strand | 148-151 | 4 | 3 |
| β-strand | 158 | 1 | 4 |
| β-strand | 161 | 1 | 4 |
| β-strand | 162-163 | 2 | 3 |
| α-helix | 164-171 | 8 | |
| α-helix | 173 | 1 | |
| β-strand | 192-197 | 6 | 3 |
| β-strand | 207-211 | 5 | 3 |
| α-helix | 212-222 | 11 | |
| β-strand | 236-239 | 4 | 2 |
| α-helix | 246-258 | 13 | |
| β-strand | 261-264 | 4 | 2 |
| α-helix | 270-279 | 10 | |
| β-strand | 284-286 | 3 | 2 |
| α-helix | 289-297 | 9 | |
| α-helix | 301-303 | 3 | |
| β-strand | 311-313 | 3 | 2 |
| α-helix | 321-330 | 10 | |
| β-strand | 337 | 1 | 2 |
| β-strand | 339-341 | 3 | 5 |
| α-helix | 343-345 | 3 | |
| β-strand | 348-351 | 4 | 5 |
| β-strand | 363 | 1 | 1 |
| β-strand | 364-365 | 2 | 5 |
| α-helix | 366 | 1 | |
| β-strand | 370-374 | 5 | 1 |
| β-strand | 381 | 1 | 1 |
| β-strand | 388-393 | 6 | 1 |
| β-strand | 400-401 | 2 | 3 |
| α-helix | 405-411 | 7 | |
| β-strand | 412 | 1 | 1 |
| β-strand | 418-426 | 9 | 1 |
| β-strand | 432-434 | 3 | 1 |
| α-helix | 437-439 | 3 | |
| β-strand | 442-444 | 3 | 6 |
| β-strand | 447-449 | 3 | 6 |
| α-helix | 451-459 | 9 | |
| β-strand | 464-474 | 11 | 6 |
| β-strand | 478-487 | 10 | 6 |
| α-helix | 488 | 1 | |
| α-helix | 495-503 | 9 | |
| β-strand | 515-518 | 4 | 6 |
| β-strand | 524 | 1 | 7 |
| β-strand | 530 | 1 | 7 |
| α-helix | 532-542 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Luciferase | A | protein | 550 | Photinus pyralis | P08659 (AlphaFold model) |
>1BA3_1 LUCIFERASE (chains A) MEDAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAHIEVNITYAEYFEMS VRLAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMNI SQPTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEYD FVPESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIIPDTAILSV VPFHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTL IDKYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPG AVGKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHS GDIAYWDEDEHFFIVDRLKSLIKYKGYQVAPAELESILLQHPNIFDAGVAGLPDDDAGEL PAAVVVLEHGKTMTEKEIVDYVASQVTTAKKLRGGVVFVDEVPKGLTGKLDARKIREILI KAKKGGKSKL
| ID | Name | Formula | Copies |
|---|---|---|---|
| MBR | Tribromomethane | C H Br3 | 2 |
Structural basis for the inhibition of firefly luciferase by a general anesthetic. Franks, N.P., Jenkins, A., Conti, E. et al. Biophys J (1998) 75:2205-2211. PubMed
Other PDB entries of the same protein (UniProt P08659 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BA3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.