luciferase complex with 7-cy-L. Determined by X-ray diffraction at 2.0 Å resolution. Released 27 Sept 2017.
Explore 5GZ2 in 3D Show helices and sheets RCSB PDB PDBe
5GZ2 contains 20 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 8-9 | 2 | 1 |
| α-helix | 22-34 | 13 | |
| β-strand | 40-44 | 5 | 2 |
| β-strand | 50-52 | 3 | 2 |
| α-helix | 53-70 | 18 | |
| β-strand | 77-81 | 5 | 3 |
| α-helix | 89-98 | 10 | |
| β-strand | 101-105 | 5 | 3 |
| α-helix | 111-121 | 11 | |
| β-strand | 125-128 | 4 | 3 |
| α-helix | 130-132 | 3 | |
| α-helix | 133-142 | 10 | |
| β-strand | 148-151 | 4 | 3 |
| β-strand | 158 | 1 | 4 |
| β-strand | 161 | 1 | 4 |
| β-strand | 162-163 | 2 | 3 |
| α-helix | 164-169 | 6 | |
| α-helix | 172-173 | 2 | |
| β-strand | 192-197 | 6 | 3 |
| α-helix | 198 | 1 | |
| β-strand | 207-211 | 5 | 3 |
| α-helix | 212-223 | 12 | |
| β-strand | 236-239 | 4 | 2 |
| α-helix | 246-257 | 12 | |
| β-strand | 261-264 | 4 | 2 |
| α-helix | 270-279 | 10 | |
| β-strand | 284-287 | 4 | 2 |
| α-helix | 289-295 | 7 | |
| α-helix | 301-303 | 3 | |
| β-strand | 311-315 | 5 | 2 |
| α-helix | 321-330 | 10 | |
| β-strand | 337-340 | 4 | 2 |
| α-helix | 343-345 | 3 | |
| β-strand | 350-351 | 2 | 2 |
| β-strand | 363 | 1 | 1 |
| β-strand | 364-365 | 2 | 2 |
| α-helix | 366 | 1 | |
| β-strand | 370-374 | 5 | 1 |
| α-helix | 380 | 1 | |
| β-strand | 381 | 1 | 1 |
| α-helix | 382 | 1 | |
| β-strand | 388-393 | 6 | 1 |
| β-strand | 400-401 | 2 | 3 |
| β-strand | 404 | 1 | 3 |
| α-helix | 405-409 | 5 | |
| β-strand | 412 | 1 | 1 |
| β-strand | 418-426 | 9 | 1 |
| β-strand | 432-435 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Luciferin 4-monooxygenase | A | protein | 436 | Photinus pyralis | P08659 (AlphaFold model) |
>5GZ2_1 Luciferin 4-monooxygenase (chains A) DAKNIKKGPAPFYPLEDGTAGEQLHKAMKRYALVPGTIAFTDAHIEVNITYAEYFEMSVR LAEAMKRYGLNTNHRIVVCSENSLQFFMPVLGALFIGVAVAPANDIYNERELLNSMNISQ PTVVFVSKKGLQKILNVQKKLPIIQKIIIMDSKTDYQGFQSMYTFVTSHLPPGFNEYDFV PESFDRDKTIALIMNSSGSTGLPKGVALPHRTACVRFSHARDPIFGNQIIPDTAILSVVP FHHGFGMFTTLGYLICGFRVVLMYRFEEELFLRSLQDYKIQSALLVPTLFSFFAKSTLID KYDLSNLHEIASGGAPLSKEVGEAVAKRFHLPGIRQGYGLTETTSAILITPEGDDKPGAV GKVVPFFEAKVVDLDTGKTLGVNQRGELCVRGPMIMSGYVNNPEATNALIDKDGWLHSGD IAYWDEDEHFFIVDRL
| ID | Name | Formula | Copies |
|---|---|---|---|
| 7BV | (4S)-2-[6-(azepan-1-yl)-1,3-benzothiazol-2-yl]-4,5-dihydro-1,3-thiazole-4-carbo… | C17 H19 N3 O2 S2 | 1 |
luciferase complex with 7-cy-L. Su, J., Wang, F. To be published.
Other PDB entries of the same protein (UniProt P08659 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 5GZ2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.