Signal transduction pleckstrin homology domain of G-protein coupled receptor kinase 2 (beta-adrenergic receptor kinase 1), C-terminal extended, NMR, 20 structures. Determined by solution NMR. Released 25 Feb 1998.
Explore 1BAK in 3D Show helices and sheets RCSB PDB PDBe
1BAK contains 1 α-helix and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 561-568 | 8 | 1 |
| β-strand | 578-583 | 6 | 1 |
| β-strand | 587-591 | 5 | 1 |
| β-strand | 600-602 | 3 | 1 |
| β-strand | 606-612 | 7 | 1 |
| β-strand | 619-624 | 6 | 1 |
| β-strand | 629-633 | 5 | 1 |
| α-helix | 637-658 | 22 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| G-protein coupled receptor kinase 2 | A | protein | 119 | Homo sapiens | P25098 (AlphaFold model) |
>1BAK_1 G-PROTEIN COUPLED RECEPTOR KINASE 2 (chains A) GSHMGKDCIMHGYMSKMGNPFLTQWQRRYFYLFPNRLEWRGEGEAPQSLLTMEEIQSVEE TQIKERKCLLLKIRGGKQFILQCDSDPELVQWKKELRDAYREAQQLVQRVPKMKNKPRS
The solution structure and dynamics of the pleckstrin homology domain of G protein-coupled receptor kinase 2 (beta-adrenergic receptor kinase 1). A binding partner of Gbetagamma subunits. Fushman, D., Najmabadi-Haske, T., Cahill, S. et al. J Biol Chem (1998) 273:2835-2843. DOI 10.1074/jbc.273.5.2835 · PubMed
Other PDB entries of the same protein (UniProt P25098 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BAK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.