1BEB: Bovine beta-lactoglobulin, lattice X

Name: PDB 1BEB: Bovine beta-lactoglobulin, lattice X
Published: 1997-05-15
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: lipocalin

Bovine beta-lactoglobulin, lattice X. Determined by X-ray diffraction at 1.8 Å resolution. Released 15 May 1997.

Method: X-ray diffraction
Resolution: 1.8 Å
Organism: Bos taurus
Chains: 2
Atoms: 2,668
Mol. weight: 36.75 kDa
Released: 15 May 1997

Explore 1BEB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BEB contains 12 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	6-7	2
α-helix	12-15	4
β-strand	17-18	2	1
β-strand	20-26	7	2
α-helix	29-31	3
β-strand	42-48	7	1
β-strand	54-61	8	1
β-strand	66-73	8	1
β-strand	74-75	2	2
β-strand	81-86	6	2
β-strand	89-97	9	2
β-strand	102-108	7	2
α-helix	113-115	3
β-strand	118-123	6	2
α-helix	130-140	11
β-strand	147-150	4	2
α-helix	153-156	4

Chain B: 6 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	12-15	4
β-strand	17-18	2	3
β-strand	20-26	7	2
α-helix	29-31	3
β-strand	41-48	8	3
β-strand	54-61	8	3
β-strand	66-73	8	3
β-strand	74-75	2	2
β-strand	81-86	6	2
β-strand	89-97	9	2
β-strand	102-108	7	2
α-helix	113-115	3
β-strand	118-123	6	2
α-helix	130-139	10
α-helix	140-142	3
β-strand	147-150	4	2
α-helix	153-158	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Beta-lactoglobulin	A, B	protein	162	Bos taurus	P02754 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1BEB_1 BETA-LACTOGLOBULIN (chains A, B)
LIVTQTMKGLDIQKVAGTWYSLAMAASDISLLDAQSAPLRVYVEELKPTPEGDLEILLQK
WENGECAQKKIIAEKTKIPAVFKIDALNENKVLVLDTDYKKYLLFCMENSAEPEQSLVCQ
CLVRTPEVDDEALEKFDKALKALPMHIRLSFNPTQLEEQCHI

Primary citation

Bovine beta-lactoglobulin at 1.8 A resolution--still an enigmatic lipocalin. Brownlow, S., Morais Cabral, J.H., Cooper, R. et al. Structure (1997) 5:481-495. DOI 10.1016/S0969-2126(97)00205-0 · PubMed

Other PDB entries of the same protein (UniProt P02754 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Q19 1.55 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W) in complex with desipramine (FAW-DSM#3)
4GNY 1.64 Å, Bovine beta-lactoglobulin complex with dodecyl sulfate
7Q2P 1.69 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W) in complex with desipramine (FAW-DSM#2)
5NUK 1.7 Å, Engineered beta-lactoglobulin: variant I56F-L39A-M107F in complex with chlorpromazine…
7Q2N 1.7 Å, Beta-lactoglobulin mutant FAF (I56F/L39A/M107F) in complex with desipramine (FAF-DSM)
7KOT 1.74 Å, Energetic and structural effects of the Tanford transition on the ligand recognition of…
7BF8 1.8 Å, Mutant I56F of recombinant bovine beta-lactoglobulin in complex with tetracaine
7BF9 1.8 Å, Mutant M107L of recombinant bovine beta-lactoglobulin in complex with tetracaine
7Q17 1.8 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W), unliganded form
7Q2O 1.8 Å, Beta-lactoglobulin mutant FAW (I56F/L39A/M107W) in complex with desipramine (FAW-DSM#1)
7Q18 1.8 Å, Beta-lactoglobulin mutant FAF (I56F/L39A/M107F), unliganded form
4KII 1.85 Å, Beta-lactoglobulin in complex with Cp*Rh(III)Cl N,N-di(pyridin-2-yl)dodecanamide

Browse structure collections

About this viewer

MolViewer shows 1BEB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.