Beta chain of a T cell antigen receptor. Determined by X-ray diffraction at 1.7 Å resolution. Released 25 Oct 1995.
Explore 1BEC in 3D Show helices and sheets RCSB PDB PDBe
1BEC contains 7 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-7 | 4 | 1 |
| β-strand | 10-14 | 5 | 2 |
| β-strand | 19-25 | 7 | 1 |
| β-strand | 31-37 | 7 | 2 |
| β-strand | 39 | 1 | 3 |
| β-strand | 41 | 1 | 3 |
| β-strand | 43-51 | 9 | 2 |
| β-strand | 54-57 | 4 | 2 |
| β-strand | 66-68 | 3 | 1 |
| β-strand | 74-79 | 6 | 1 |
| α-helix | 84-86 | 3 | |
| β-strand | 88-95 | 8 | 2 |
| α-helix | 101-105 | 3 | |
| β-strand | 107-108 | 2 | 2 |
| β-strand | 112-116A | 6 | 2 |
| α-helix | 119-121 | 3 | |
| β-strand | 123 | 1 | 4 |
| α-helix | 124-125 | 2 | |
| β-strand | 126-130 | 5 | 5 |
| β-strand | 145-152 | 8 | 5 |
| β-strand | 153 | 1 | 4 |
| β-strand | 157-163 | 7 | 6 |
| β-strand | 166-168 | 3 | 6 |
| β-strand | 172-174 | 3 | 5 |
| β-strand | 179-182 | 4 | 5 |
| β-strand | 189-196 | 8 | 5 |
| α-helix | 200-203 | 4 | |
| β-strand | 209-216 | 8 | 6 |
| α-helix | 225-226 | 2 | |
| α-helix | 230-232 | 3 | |
| β-strand | 236-242 | 7 | 6 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 14.3.D T cell antigen receptor | A | protein | 238 | Mus musculus | P01851 (AlphaFold model) |
>1BEC_1 14.3.D T CELL ANTIGEN RECEPTOR (chains A) AVTQSPRNKVAVTGGKVTLSCQQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDIPD GYKASRPSQEQFSLILELATPSQTSVYFCASGGGRGSYAEQFFGPGTRLTVLEDLRQVTP PKVSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNY SYCLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRAD
Crystal structure of the beta chain of a T cell antigen receptor. Bentley, G.A., Boulot, G., Karjalainen, K. et al. Science (1995) 267:1984-1987. PubMed
Other PDB entries of the same protein (UniProt P01851 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BEC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.