1MWA: 2C/H-2KBM3/DEV8 allogeneic complex

2C/H-2KBM3/DEV8 allogeneic complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 27 Nov 2002.

Method: X-ray diffraction
Resolution: 2.4 Å
Organism: Mus musculus
Chains: 10
Atoms: 13,973
Mol. weight: 189.31 kDa
Ligands: NAG
Released: 27 Nov 2002

Explore 1MWA in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1MWA contains 37 α-helices and 139 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 17 β-strands

Element	Residues	Length	Sheet
β-strand	2-4	3	1
β-strand	9-13	5	2
β-strand	18-20	3	1
β-strand	23-25	3	1
α-helix	29-30	2
β-strand	31-37	7	2
β-strand	43-49	7	2
β-strand	55-57	3	1
β-strand	63-67	5	1
β-strand	72-77	6	1
α-helix	82-84	3
β-strand	86-93	8	2
α-helix	104	1
β-strand	105-106	2	2
β-strand	110-115	6	2
β-strand	124-127	4	3
β-strand	141-144	4	3
β-strand	160-162	3	3
α-helix	163-165	3
β-strand	166-169	4	3
β-strand	176-184	9	3
α-helix	191-194	4

Chain B: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	11
β-strand	10-14	5	12
β-strand	19-25	7	11
β-strand	31-37	7	12
β-strand	43-49	7	12
β-strand	56-57	2	12
β-strand	66-71	6	11
β-strand	74-79	6	11
α-helix	84-86	3
β-strand	88-95	8	12
β-strand	106-108	3	12
β-strand	112-316	6	12
α-helix	124-125	2
β-strand	126-130	5	13
α-helix	131-133	3
α-helix	134-140	7
β-strand	142-152	11	13
β-strand	157-163	7	14
β-strand	166-167	2	14
β-strand	172-174	3	13
α-helix	178	1
β-strand	179-180	2	13
β-strand	190-199	10	13
α-helix	200-204	5
β-strand	209-216	8	14
β-strand	219	1	15
β-strand	233	1	15
β-strand	235-242	8	14

Chain C: 4 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-4	2	4
β-strand	10-13	4	5
β-strand	18-20	3	6
β-strand	23-24	2	4
β-strand	31-37	7	5
β-strand	44-48	5	5
β-strand	55	1	7
β-strand	62-64	3	6
β-strand	65	1	7
β-strand	67	1	4
β-strand	72	1	4
β-strand	75-77	3	6
α-helix	82-84	3
β-strand	86-93	8	5
α-helix	103-104	2
β-strand	105-106	2	5
α-helix	107	1
β-strand	111-115	5	5
β-strand	129	1	8
β-strand	141	1	9
α-helix	151-152	2
β-strand	166-168	3	10
β-strand	177-179	3	10
β-strand	182	1	9

Chain D: 4 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	11	1	16
β-strand	20-22	3	17
β-strand	31-37	7	16
β-strand	38	1	18
β-strand	42	1	18
β-strand	45-49	5	16
β-strand	56-57	2	16
β-strand	66	1	17
β-strand	76-78	3	17
α-helix	84-86	3
β-strand	88-95	8	16
β-strand	112-114	3	16
α-helix	123-125	3
β-strand	131	1	8
β-strand	144-148	5	19
β-strand	159-163	5	20
β-strand	166	1	20
β-strand	179	1	21
β-strand	191	1	21
β-strand	193-197	5	19
α-helix	200-203	4
β-strand	209	1	22
β-strand	210-214	5	20
β-strand	238-239	2	20
β-strand	242	1	22
α-helix	243-246	4

Chain H: 8 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	3-14	12	23
β-strand	18-28	11	23
β-strand	31-37	7	23
β-strand	46-47	2	23
α-helix	50-54	5
α-helix	57-84	28
β-strand	94-103	10	23
β-strand	109-118	10	23
β-strand	121-125	5	23
β-strand	126	1	24
β-strand	133	1	24
α-helix	138-149	12
α-helix	152-158	7
α-helix	159-163	5
α-helix	164-179	16
β-strand	183	1	25
α-helix	184-185	2
β-strand	186-193	8	26
β-strand	198-208	11	26
β-strand	209	1	25
β-strand	215-219	5	27
β-strand	222-223	2	27
β-strand	229-230	2	26
α-helix	231-233	3
β-strand	234-235	2	26
β-strand	241-250	10	26
β-strand	257-261	5	27
β-strand	270-273	4	27

Chain I: 9 helices, 19 β-strands

Element	Residues	Length	Sheet
β-strand	3-14	12	28
β-strand	18-28	11	28
β-strand	31-37	7	28
β-strand	46-47	2	28
α-helix	50-53	4
α-helix	59-84	26
β-strand	95-103	9	28
β-strand	111-118	8	28
β-strand	121-122	2	28
β-strand	125-126	2	29
β-strand	133-134	2	29
α-helix	141-145	5
α-helix	152-154	3
α-helix	155-157	3
α-helix	158-164	7
α-helix	165-179	15
β-strand	183	1	30
β-strand	186-194	9	31
β-strand	198-208	11	31
β-strand	209	1	30
β-strand	214-219	6	32
β-strand	228-230	3	31
α-helix	231-233	3
β-strand	234-235	2	31
β-strand	241-250	10	31
α-helix	254-256	3
β-strand	257-262	6	32
β-strand	270-273	4	32

Chain L: 1 helix, 11 β-strands

Element	Residues	Length	Sheet
β-strand	3	1	33
α-helix	4-5	2
β-strand	6-11	6	34
β-strand	21-30	10	34
β-strand	31	1	33
β-strand	36-41	6	35
β-strand	44-45	2	35
β-strand	50-51	2	34
β-strand	55-56	2	34
β-strand	62-70	9	34
β-strand	78-83	6	35
β-strand	91-94	4	35

Chain M: 0 helices, 8 β-strands

Element	Residues	Length	Sheet
β-strand	6-10	5	36
β-strand	21-30	10	36
β-strand	36-39	4	37
β-strand	51	1	36
β-strand	55-56	2	36
β-strand	62-70	9	36
β-strand	79-84	6	37
β-strand	87-94	8	37

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
2C T cell receptor alpha chain	A, C	protein	202	Mus musculus	P01738 (AlphaFold model)
2C T cell receptor beta chain	B, D	protein	237	Mus musculus	P01851 (AlphaFold model)
H-2KBM3 MHC class I molecule heavy chain	H, I	protein	275	Mus musculus	P01901 (AlphaFold model)
Microglobulin MHC light chain	L, M	protein	99	Mus musculus	P01887 (AlphaFold model)
DEV8	P, Q	protein	8		Q62425

Sequence of entity 1 (A, C), FASTA

>1MWA_1 2C T CELL RECEPTOR ALPHA CHAIN (chains A, C)
QSVTQPDARVTVSEGASLQLRCKYSYSATPYLFWYVQYPRQGLQLLLKYYSGDPVVQGVN
GFEAEFSKSNSSFHLRKASVHWSDSAVYFCAVSGFASALTFGSGTKVIVLPYIQNPEPAV
YALKDPRSQDSTLCLFTDFDSQINVPKTMESGTFITDATVLDMKAMDSKSNGAIAWSNQT
SFTCQDIFKETNATYPSSDVPC

Sequence of entity 2 (B, D), FASTA

>1MWA_2 2C T CELL RECEPTOR BETA CHAIN (chains B, D)
EAAVTQSPRNKVAVTGGKVTLSCNQTNNHNNMYWYRQDTGHGLRLIHYSYGAGSTEKGDI
PDGYKASRPSQENFSLILELATPSQTSVYFCASGGGGTLYFGAGTRLSVLEDLRNVTPPK
VSLFEPSKAEIANKQKATLVCLARGFFPDHVELSWWVNGKEVHSGVSTDPQAYKESNYSY
CLSSRLRVSATFWHNPRNHFRCQVQFHGLSEEDKWPEGSPKPVTQNISAEAWGRADC

Sequence of entity 3 (H, I), FASTA

>1MWA_3 H-2KBM3 MHC CLASS I MOLECULE HEAVY CHAIN (chains H, I)
GPHSLRYFVTAVSRPGLGEPRYMEVGYVDDTEFVRFDSDAENPRYEPRARWMEQEGPEYW
ERETQKAKGNEQSFRVSLRTLLGYYNQSAGGSHTIQVISGCEVGSDGRLLRGYQQYAYDG
CDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLL
RTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGT
FQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWR

Sequence of entity 4 (L, M), FASTA

>1MWA_4 MICROGLOBULIN MHC LIGHT CHAIN (chains L, M)
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDW
SFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM

Sequence of entity 5 (P, Q), FASTA

>1MWA_5 DEV8 (chains P, Q)
EQYKFYSV

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Water and common crystallization additives (GOL, ACY) are not listed.

Primary citation

Structural comparison of allogeneic and syngeneic T cell receptor-peptide-major histocompatibility complex complexes: a buried alloreactive mutation subtly alters peptide presentation substantially increasing V(beta) Interactions. Luz, J.G., Huang, M.D., Garcia, K.C. et al. J Exp Med (2002) 195:1175-1186. DOI 10.1084/jem.20011644 · PubMed

Other PDB entries of the same protein (UniProt P01738 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2OI9 2.35 Å, Structure of the 2C/Ld/QL9 allogeneic complex
2ICW 2.41 Å, Crystal structure of a complete ternary complex between TCR, superantigen, and…
1I9E 2.5 Å, TCR domain
1TCR 2.5 Å, Murine T-cell antigen receptor 2C clone
4MXQ 2.6 Å, 42F3 TCR pCPC5/H-2Ld Complex
1G6R 2.8 Å, A functional hot spot for antigen recognition in a superagonist tcr/mhc complex
4N0C 2.9 Å, 42F3 TCR pCPE3/H-2Ld complex
4NHU 2.9 Å, The M33 TCR p3M33l/H-2 Ld Complex
3E3Q 2.95 Å, Structure of the 3alpham13 high-affinity mutant of the 2C TCR in complex with Ld/QL9
2CKB 3.0 Å, Structure of the 2C/KB/DEV8 complex
4N5E 3.06 Å, 42F3 TCR pCPA12/H-2Ld complex
4MVB 3.09 Å, 42F3 pCPB7/H-2Ld Complex

Browse structure collections

About this viewer

MolViewer shows 1MWA directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.