1BEY: Antibody to campath-1H humanized FAB

Name: PDB 1BEY: Antibody to campath-1H humanized FAB
Published: 1999-01-27
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: antibody

Antibody to campath-1H humanized FAB. Determined by X-ray diffraction at 3.25 Å resolution. Released 27 Jan 1999.

Method: X-ray diffraction
Resolution: 3.25 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,252
Mol. weight: 47.01 kDa
Released: 27 Jan 1999

Explore 1BEY in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BEY contains 5 α-helices and 53 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 2 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	12
β-strand	11-12	2	13
β-strand	17-20	4	14
β-strand	23-25	3	12
α-helix	29-31	3
β-strand	33-39	7	15
β-strand	46-51	6	15
β-strand	60-62	3	15
β-strand	83-86	4	14
β-strand	94-101	8	15
β-strand	116-117	2	15
β-strand	118-119	2	13
β-strand	128-132	5	16
β-strand	147-153	7	16
α-helix	157	1
β-strand	159-162	4	17
β-strand	172	1	16
β-strand	178	1	16
β-strand	184-186	3	16
β-strand	189	1	16
β-strand	203	1	18
β-strand	204-208	5	17
β-strand	213-215	3	17
β-strand	218	1	18

Chain L: 3 helices, 31 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-11	2	2
β-strand	14	1	3
β-strand	15	1	4
α-helix	18	1
β-strand	19-25	7	1
β-strand	30	1	5
β-strand	33-37	5	2
β-strand	45-49	5	2
β-strand	53-54	2	2
β-strand	62-65	4	1
β-strand	68	1	5
β-strand	72-75	4	1
β-strand	78	1	4
β-strand	85-90	6	2
β-strand	97-98	2	2
β-strand	102-104	3	2
α-helix	105-106	2
β-strand	107	1	3
β-strand	118	1	6
β-strand	125	1	7
β-strand	129	1	7
β-strand	132	1	8
β-strand	133	1	6
β-strand	135	1	9
β-strand	139	1	10
β-strand	144-149	6	11
β-strand	161-163	3	9
α-helix	165-167	3
β-strand	173	1	10
β-strand	175-177	3	9
β-strand	179	1	8
β-strand	193-198	6	11
β-strand	205-206	2	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Campath-1H antibody	L	protein	214	Homo sapiens	Q6GMX0 (AlphaFold model)
Campath-1H antibody	H	protein	219	Homo sapiens	P01857 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1BEY_1 CAMPATH-1H ANTIBODY (chains L)
DIQMTQSPSSLSASVGDRVTITCKASQNIDKYLNWYQQKPGKAPKLLIYNTNNLQTGVPS
RFSGSGSGTDFTFTISSLQPEDIATYYCLQHISRPRTFGQGTKVEIKRTVAAPSVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC

Sequence of entity 2 (H), FASTA

>1BEY_2 CAMPATH-1H ANTIBODY (chains H)
QVQLQESGPGLVRPSQTLSLTCTVSGFTFTDFYMNWVRQPPGRGLEWIGFIRDKAKGYTT
EYNPSVKGRVTMLVDTSKNQFSLRLSSVTAADTAVYYCAREGHTAAPFDYWGQGSLVTVS
SASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQS
SGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKV

Primary citation

Crystal structures of a rat anti-CD52 (CAMPATH-1) therapeutic antibody Fab fragment and its humanized counterpart. Cheetham, G.M., Hale, G., Waldmann, H. et al. J Mol Biol (1998) 284:85-99. DOI 10.1006/jmbi.1998.2157 · PubMed

Other PDB entries of the same protein (UniProt Q6GMX0 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6UCF 1.29 Å, N123-VRC34_pI4 HIV neutralizing antibody in complex with HIV fusion peptide residue…
6UCE 1.38 Å, N123-VRC34_pI3 HIV neutralizing antibody in complex with HIV fusion peptide residue…
2D7T 1.7 Å, Crystal structure of human anti polyhydroxybutyrate antibody Fv
6UBI 1.9 Å, N123-VRC34.05 HIV neutralizing antibody in complex with HIV fusion peptide residue 512-519
3BN9 2.17 Å, Crystal Structure of MT-SP1 in complex with Fab Inhibitor E2
8CWK 2.37 Å, Fab arm of antibodies 4G1-C2 and 10G4 bound to CoV-2 receptor binding domain (RBD)
5O1R 2.86 Å, human Fab 5H2 bound to NHBA-C3 from Neisseria meningitidis serogroup B
5VOB 3.02 Å, Crystal structure of HCMV Pentamer in complex with neutralizing antibody 8I21
6B70 3.7 Å, Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11-E heavy…
5VOC 3.99 Å, Crystal structure of HCMV Pentamer in complex with neutralizing antibody 8I21 - Low…
6B7Z 6.5 Å, Cryo-EM structure of human insulin degrading enzyme in complex with FAB H11 heavy chain…

Browse structure collections

About this viewer

MolViewer shows 1BEY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.