Basic fibroblast growth factor complexed with heparin hexamer fragment. Determined by X-ray diffraction at 2.2 Å resolution. Released 3 Apr 1996.
Explore 1BFC in 3D Show helices and sheets RCSB PDB PDBe
1BFC contains 4 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 22 | 1 | 1 |
| β-strand | 24-26 | 3 | 1 |
| β-strand | 31-35 | 5 | 1 |
| β-strand | 41-44 | 4 | 1 |
| α-helix | 50-52 | 3 | |
| β-strand | 54-58 | 5 | 1 |
| β-strand | 63-68 | 6 | 1 |
| β-strand | 73-77 | 5 | 1 |
| β-strand | 83-86 | 4 | 1 |
| α-helix | 91-93 | 3 | |
| β-strand | 95-99 | 5 | 1 |
| α-helix | 101-103 | 3 | |
| β-strand | 105-109 | 5 | 1 |
| β-strand | 116 | 1 | 1 |
| β-strand | 119 | 1 | 2 |
| β-strand | 125 | 1 | 2 |
| α-helix | 128-130 | 3 | |
| β-strand | 140-142 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Basic fibroblast growth factor | A | protein | 147 | Homo sapiens | P09038 (AlphaFold model) |
>1BFC_1 BASIC FIBROBLAST GROWTH FACTOR (chains A) LPALPEDGGSGAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEE RGVVSIKGVSANRYLAMKEDGRLLASKSVTDECFFFERLESNNYNTYRSRKYTSWYVALK RTGQYKLGSKTGPGQKAILFLPMSAKS
Heparin structure and interactions with basic fibroblast growth factor. Faham, S., Hileman, R.E., Fromm, J.R. et al. Science (1996) 271:1116-1120. PubMed
Other PDB entries of the same protein (UniProt P09038 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BFC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.