Crystal structure of FGF2-STAB, a stable variant of human fibroblast growth factor 2. Determined by X-ray diffraction at 1.31 Å resolution. Released 6 Mar 2024.
Explore 8OM6 in 3D Show helices and sheets RCSB PDB PDBe
8OM6 contains 6 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 27-29 | 3 | |
| β-strand | 30-34 | 5 | 1 |
| β-strand | 39-43 | 5 | 1 |
| β-strand | 49-52 | 4 | 1 |
| α-helix | 58-60 | 3 | |
| β-strand | 62-66 | 5 | 1 |
| β-strand | 71-76 | 6 | 1 |
| β-strand | 81-85 | 5 | 1 |
| β-strand | 91-94 | 4 | 1 |
| α-helix | 99-101 | 3 | |
| β-strand | 103-107 | 5 | 1 |
| β-strand | 113-117 | 5 | 1 |
| β-strand | 124 | 1 | 1 |
| β-strand | 127 | 1 | 2 |
| β-strand | 132 | 1 | 1 |
| β-strand | 133 | 1 | 2 |
| α-helix | 134-135 | 2 | |
| α-helix | 136-138 | 3 | |
| α-helix | 144-146 | 3 | |
| β-strand | 148-152 | 5 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Fibroblast growth factor 2 | A | protein | 175 | Homo sapiens | P09038 (AlphaFold model) |
>8OM6_1 Fibroblast growth factor 2 (chains A) MGSSHHHHHHSSGLVPRGSHMAAGSITTLPALPEDGGSGAFPPGHFKDPKLLYCKNGGFF LRIHPDGRVDGTRDKSDPFIKLQLQAEERGVVSIKGVCANRYLAMKEDGRLYAIKNVTDE CFFFERLEENNYNTYRSRKYPSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
Structural analysis of the stable form of fibroblast growth factor 2 - FGF2-STAB. de La Bourdonnaye, G., Marek, M., Ghazalova, T. et al. J Struct Biol X (2024) 10:100112-100112. DOI 10.1016/j.yjsbx.2024.100112 · PubMed
Other PDB entries of the same protein (UniProt P09038 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8OM6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.