1BFF: Basic fibroblast growth factor

Name: PDB 1BFF: The 154 amino acid form of human basic fibroblast growth factor
Published: 1997-06-16
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: growth factor

The 154 amino acid form of human basic fibroblast growth factor. Determined by X-ray diffraction at 2.0 Å resolution. Released 16 Jun 1997.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,115
Mol. weight: 14.97 kDa
Ligands: PO4
Released: 16 Jun 1997

Explore 1BFF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BFF contains 5 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	29-33	5	1
α-helix	38	1
β-strand	39-42	4	1
β-strand	48-51	4	1
α-helix	57-59	3
β-strand	61-67	7	1
β-strand	70-75	6	1
β-strand	80-84	5	1
β-strand	90-93	4	1
β-strand	102-106	5	1
β-strand	112-116	5	1
β-strand	123	1	1
β-strand	126	1	2
β-strand	132	1	2
α-helix	133-134	2
α-helix	135-137	3
α-helix	143-145	3
β-strand	147-151	5	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Basic fibroblast growth factor	A	protein	129	Homo sapiens	P09038 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BFF_1 BASIC FIBROBLAST GROWTH FACTOR (chains A)
KDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGVCANRYLAMK
EDGRLLASKCVTDECFFFERLESNNYNTYRSRKYTSWYVALKRTGQYKLGSKTGPGQKAI
LFLPMSAKS

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1

Water and common crystallization additives (BME) are not listed.

Primary citation

X-ray structure of the 154-amino-acid form of recombinant human basic fibroblast growth factor. comparison with the truncated 146-amino-acid form. Kastrup, J.S., Eriksson, E.S., Dalboge, H. et al. Acta Crystallogr D Biol Crystallogr (1997) 53:160-168. DOI 10.1107/S0907444996012711 · PubMed

Other PDB entries of the same protein (UniProt P09038 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8OM6 1.31 Å, Crystal structure of FGF2-STAB, a stable variant of human fibroblast growth factor 2
8HU7 1.4 Å, Crystal structure of FGF2-M1 mutant - D28E/C78L/C96I/S137P
8HUE 1.48 Å, Crystal structure of FGF2-M2 mutant - D28E/C78I/C96I/S137P
4OEE 1.5 Å, Crystal Structure Analysis of FGF2-Disaccharide (S3I2) complex
1BFG 1.6 Å, Crystal structure of basic fibroblast growth factor at 1.6 Å resolution
4FGF 1.6 Å, Refinement of the structure of human basic fibroblast growth factor at 1.6 Å resolution…
4OEG 1.6 Å, Crystal Structure Analysis of FGF2-Disaccharide (S9I2) complex
2FGF 1.77 Å, Three-dimensional structure of human basic fibroblast growth factor, A structural…
4OEF 1.8 Å, Crystal Structure Analysis of FGF2-Disaccharide (S6I2) complex
1BAS 1.9 Å, Three-dimensional structures of acidic and basic fibroblast growth factors
1BFB 1.9 Å, Basic fibroblast growth factor complexed with heparin tetramer fragment
5X1O 1.9 Å, PI(4,5)P2 lipid binding induced a reorientation of FGF2 molecules near membrane surface…

Browse structure collections

About this viewer

MolViewer shows 1BFF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.