1BFT: Nf-kb P65 homodimer

Structure of nf-kb P65 homodimer bound to a kb site. Determined by X-ray diffraction at 2.0 Å resolution. Released 28 Jan 1998.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Mus musculus
Chains: 2
Atoms: 1,699
Mol. weight: 22.95 kDa
Released: 28 Jan 1998

Explore 1BFT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BFT contains 9 α-helices and 22 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	196-199	4	1
β-strand	203-205	3	2
β-strand	211-216	6	1
α-helix	221-223	3
β-strand	225-230	6	2
β-strand	233-236	4	2
β-strand	238	1	1
α-helix	241-243	3
β-strand	244	1	1
β-strand	249-253	5	1
α-helix	254-257	4
β-strand	266-274	9	2
α-helix	275-277	3
β-strand	279-280	2	2
α-helix	281-283	3
β-strand	284-289	6	2

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	196-199	4	3
β-strand	203-205	3	4
β-strand	211-216	6	3
α-helix	221-223	3
β-strand	225-230	6	4
β-strand	233-236	4	4
β-strand	238	1	3
α-helix	241-243	3
β-strand	244	1	3
β-strand	249-253	5	3
α-helix	254-257	4
β-strand	266-274	9	4
β-strand	279-280	2	4
α-helix	281-283	3
β-strand	284-289	6	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Nuclear factor nf-kappa-B P65	A, B	protein	101	Mus musculus	Q04207 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1BFT_1 NUCLEAR FACTOR NF-KAPPA-B P65 (chains A, B)
TAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAI
VFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPD

Primary citation

The role of DNA in the mechanism of NFkappaB dimer formation: crystal structures of the dimerization domains of the p50 and p65 subunits. Huang, D.B., Huxford, T., Chen, Y.Q. et al. Structure (1997) 5:1427-1436. DOI 10.1016/S0969-2126(97)00293-1 · PubMed

Other PDB entries of the same protein (UniProt Q04207 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MY7 1.49 Å, NF-kappaB p65 subunit dimerization domain homodimer N202R mutation
1MY5 1.8 Å, NF-kappaB p65 subunit dimerization domain homodimer
9BDW 1.87 Å, NF-kappaB RelA homo-dimer bound to GC-centric kappaB DNA
9BDV 1.9 Å, NF-kappaB RelA homo-dimer bound to TA-centric kappaB DNA
9BDU 2.03 Å, NF-kappaB RelA homo-dimer bound to AT-centric kappaB DNA
9E6W 2.04 Å, NF-kappaB RelA homo-dimer bound to a kappaB site of Cxcl2 gene
1OY3 2.05 Å, Crystal structure of an ikbbeta/nf-kb P65 homodimer complex
6GGR 2.1 Å, Crystal structure of Salmonella zinc metalloprotease effector GtgA in complex with p65
1IKN 2.3 Å, Ikappabalpha/nf-kappab complex
2RAM 2.4 Å, A novel DNA recognition mode by nf-kb P65 homodimer
1K3Z 2.5 Å, X-ray crystal structure of the IkBb/NF-kB p65 homodimer complex
5U01 2.5 Å, Cooperative DNA binding by two RelA dimers

Browse structure collections

About this viewer

MolViewer shows 1BFT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.