1OY3: Ikbbeta/nf-kb P65 homodimer complex

Crystal structure of an ikbbeta/nf-kb P65 homodimer complex. Determined by X-ray diffraction at 2.05 Å resolution. Released 20 May 2003.

Method: X-ray diffraction
Resolution: 2.05 Å
Organism: Mus musculus
Chains: 3
Atoms: 3,884
Mol. weight: 61.82 kDa
Released: 20 May 2003

Explore 1OY3 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1OY3 contains 24 α-helices and 22 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain B: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	192-194	3
β-strand	196-199	4	3
β-strand	203-205	3	4
β-strand	211-216	6	3
β-strand	225-230	6	4
β-strand	233-236	4	4
β-strand	238	1	3
α-helix	241-243	3
β-strand	244-245	2	3
β-strand	249-253	5	3
α-helix	254-257	4
β-strand	266-274	9	4
β-strand	279-280	2	4
β-strand	284-289	6	4
α-helix	290-292	3

Chain C: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
β-strand	196-199	4	1
β-strand	203-205	3	2
β-strand	211-216	6	1
β-strand	225-230	6	2
β-strand	233-236	4	2
β-strand	238	1	1
α-helix	241-243	3
β-strand	244	1	1
β-strand	249-253	5	1
α-helix	254-257	4
β-strand	266-274	9	2
β-strand	279-280	2	2
β-strand	284-289	6	2
α-helix	294-304	11
α-helix	306-315	10

Chain D: 16 helices, 0 β-strands

Element	Residues	Length
α-helix	61-67	7
α-helix	71-81	11
α-helix	85-88	4
α-helix	97-104	8
α-helix	107-115	9
α-helix	130-134	5
α-helix	140-146	7
α-helix	150-151	2
α-helix	196-199	4
α-helix	210-216	7
α-helix	220-229	10
α-helix	244-250	7
α-helix	254-262	9
α-helix	277-282	6
α-helix	287-295	9
α-helix	298-301	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor p65	B, C	protein	136	Mus musculus	Q04207 (AlphaFold model)
transcription factor inhibitor I-kappa-B-beta	D	protein	282	Mus musculus	Q60778 (AlphaFold model)

Sequence of entity 1 (B, C), FASTA

>1OY3_1 Transcription factor p65 (chains B, C)
TAELKICRVNRNSGSCLGGDEIFLLCDKVQKEDIEVYFTGPGWEARGSFSQADVHRQVAI
VFRTPPYADPSLQAPVRVSMQLRRPSDRELSEPMEFQYLPDTDDRHRIEEKRKRTYETFK
SIMKKSPFNGPTEPRP

Sequence of entity 2 (D), FASTA

>1OY3_2 transcription factor inhibitor I-kappa-B-beta (chains D)
VFGYVTEDGDTALHLAVIHQHEPFLDFLLGFSAGHEYLDLQNDLGQTALHLAAILGEAST
VEKLYAAGAGVLVAERGGHTALHLACRVRAHTCACVLLQPRPSHPRDASDTYLTQSQDCT
PDTSHAPAAVDSQPNPENEEEPRDEDWRLQLEAENYDGHTPLHVAVIHKDAEMVRLLRDA
GADLNKPEPTCGRTPLHLAVEAQAASVLELLLKAGADPTARMYGGRTPLGSALLRPNPIL
ARLLRAHGAPEPEDGGDKLSPCSSSGSDSDSDNRDEGDEYDD

Primary citation

X-ray crystal structure of an IkappaBbeta x NF-kappaB p65 homodimer complex. Malek, S., Huang, D.B., Huxford, T. et al. J Biol Chem (2003) 278:23094-23100. DOI 10.1074/jbc.M301022200 · PubMed

Other PDB entries of the same protein (UniProt Q04207 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1MY7 1.49 Å, NF-kappaB p65 subunit dimerization domain homodimer N202R mutation
1MY5 1.8 Å, NF-kappaB p65 subunit dimerization domain homodimer
9BDW 1.87 Å, NF-kappaB RelA homo-dimer bound to GC-centric kappaB DNA
9BDV 1.9 Å, NF-kappaB RelA homo-dimer bound to TA-centric kappaB DNA
1BFT 2.0 Å, Structure of nf-kb P65 homodimer bound to a kb site
9BDU 2.03 Å, NF-kappaB RelA homo-dimer bound to AT-centric kappaB DNA
9E6W 2.04 Å, NF-kappaB RelA homo-dimer bound to a kappaB site of Cxcl2 gene
6GGR 2.1 Å, Crystal structure of Salmonella zinc metalloprotease effector GtgA in complex with p65
1IKN 2.3 Å, Ikappabalpha/nf-kappab complex
2RAM 2.4 Å, A novel DNA recognition mode by nf-kb P65 homodimer
1K3Z 2.5 Å, X-ray crystal structure of the IkBb/NF-kB p65 homodimer complex
5U01 2.5 Å, Cooperative DNA binding by two RelA dimers

Browse structure collections

About this viewer

MolViewer shows 1OY3 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.