1BIN: Leghemoglobin a

Leghemoglobin a (acetomet). Determined by X-ray diffraction at 2.2 Å resolution. Released 12 Mar 1997.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Glycine max
Chains: 2
Atoms: 2,392
Mol. weight: 31.97 kDa
Ligands: HEM
Released: 12 Mar 1997

Explore 1BIN in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BIN contains 19 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	5-20	16
α-helix	22-36	15
α-helix	40-43	4
α-helix	45-47	3
α-helix	56-79	24
α-helix	86-92	7
α-helix	99-117	19
α-helix	118-120	3
α-helix	123-142	20

Chain B: 10 helices, 0 β-strands

Element	Residues	Length
α-helix	5-18	14
α-helix	19-21	3
α-helix	22-36	15
α-helix	38-42	5
α-helix	45-47	3
α-helix	56-79	24
α-helix	86-93	8
α-helix	99-117	19
α-helix	118-120	3
α-helix	123-141	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leghemoglobin a	A, B	protein	143	Glycine max	P02238 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1BIN_1 LEGHEMOGLOBIN A (chains A, B)
VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDPTNPKLTG
HAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDK
WSDELSRAWEVAYDELAAAIKKA

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	2

Water and common crystallization additives (SO4, ACT) are not listed.

Primary citation

Characterization of recombinant soybean leghemoglobin a and apolar distal histidine mutants. Hargrove, M.S., Barry, J.K., Brucker, E.A. et al. J Mol Biol (1997) 266:1032-1042. DOI 10.1006/jmbi.1996.0833 · PubMed

Other PDB entries of the same protein (UniProt P02238 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1FSL 2.3 Å, Ferric soybean leghemoglobin complexed with nicotinate

Browse more

1BIN is part of these collections:

Hemoglobin and oxygen transport

About this viewer

MolViewer shows 1BIN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.