1FSL: Ferric soybean leghemoglobin

Ferric soybean leghemoglobin complexed with nicotinate. Determined by X-ray diffraction at 2.3 Å resolution. Released 26 Jun 1996.

Method: X-ray diffraction
Resolution: 2.3 Å
Organism: Glycine max
Chains: 2
Atoms: 2,342
Mol. weight: 32 kDa
Ligands: HEM, NIO
Released: 26 Jun 1996

Explore 1FSL in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1FSL contains 18 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	5-20	16
α-helix	22-36	15
α-helix	40-43	4
α-helix	45-47	3
α-helix	57-79	23
α-helix	86-91	6
α-helix	99-117	19
α-helix	118-120	3
α-helix	123-141	19

Chain B: 9 helices, 0 β-strands

Element	Residues	Length
α-helix	5-19	15
α-helix	22-36	15
α-helix	40-43	4
α-helix	45-47	3
α-helix	56-78	23
α-helix	86-91	6
α-helix	99-117	19
α-helix	118-120	3
α-helix	123-140	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Leghemoglobin a	A, B	protein	143	Glycine max	P02238 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1FSL_1 LEGHEMOGLOBIN A (chains A, B)
VAFTEKQDALVSSSFEAFKANIPQYSVVFYTSILEKAPAAKDLFSFLANGVDPTNPKLTG
HAEKLFALVRDSAGQLKASGTVVADAALGSVHAQKAVTDPQFVVVKEALLKTIKAAVGDK
WSDELSRAWEVAYDELAAAIKKA

Ligands and cofactors

ID	Name	Formula	Copies
HEM	Protoporphyrin IX containing FE	C34 H32 Fe N4 O4	2
NIO	Nicotinic acid	C6 H5 N O2	2

Primary citation

Structure of ferric soybean leghemoglobin a nicotinate at 2.3 A resolution. Ellis, P.J., Appleby, C.A., Guss, J.M. et al. Acta Crystallogr D Biol Crystallogr (1997) 53:302-310. DOI 10.1107/S0907444997000292 · PubMed

Other PDB entries of the same protein (UniProt P02238 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1BIN 2.2 Å, Leghemoglobin a (acetomet)

Browse structure collections

About this viewer

MolViewer shows 1FSL directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.