1BL8: Protein

Potassium channel (KCSA) from streptomyces lividans. Determined by X-ray diffraction at 3.2 Å resolution. Released 29 Jul 1998.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Streptomyces lividans
Chains: 4
Atoms: 2,824
Mol. weight: 41.13 kDa
Released: 29 Jul 1998

Explore 1BL8 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BL8 contains 12 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C and D: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	27-51	25
α-helix	62-74	13
α-helix	86-112	27

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (potassium channel protein)	A, B, C, D	protein	97	Streptomyces lividans	P0A334 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1BL8_1 PROTEIN (POTASSIUM CHANNEL PROTEIN) (chains A, B, C, D)
ALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLY
PVTLWGRCVAVVVMVAGITSFGLVTAALATWFVGREQ

Primary citation

The structure of the potassium channel: molecular basis of K+ conduction and selectivity. Doyle, D.A., Morais Cabral, J., Pfuetzner, R.A. et al. Science (1998) 280:69-77. DOI 10.1126/science.280.5360.69 · PubMed

Other PDB entries of the same protein (UniProt P0A334 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2IH3 1.72 Å, Ion selectivity in a semi-synthetic K+ channel locked in the conductive conformation
1R3J 1.9 Å, potassium channel KcsA-Fab complex in high concentration of Tl+
2HVK 1.9 Å, crystal structure of the KcsA-Fab-TBA complex in high K+
1K4C 2.0 Å, Potassium Channel KcsA-Fab complex in high concentration of K+
2P7T 2.05 Å, Crystal Structure of KcsA mutant
6PA0 2.05 Å, Structure of the G77A mutant in Sodium Chloride
4MSW 2.06 Å, Y78 ester mutant of KcsA in high K+
6NFU 2.09 Å, Structure of the KcsA-G77A mutant or the 2,4-ion bound configuration of a K+ channel…
6NFV 2.13 Å, Structure of the KcsA-G77C mutant or the 2,4-ion bound configuration of a K+ channel…
2H8P 2.25 Å, Structure of a K channel with an amide to ester substitution in the selectivity filter
5VK6 2.25 Å, Open conformation of KcsA non-inactivating E71A mutant
5VKH 2.25 Å, Closed conformation of KcsA Y82A-F103A mutant

Browse more

1BL8 is part of these collections:

About this viewer

MolViewer shows 1BL8 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.