A fibronectin type III fold in plant allergens: The solution structure of Phl PII from timothy grass pollen, NMR, 38 STRUCTURES. Determined by solution NMR. Released 13 Jan 1999.
Explore 1BMW in 3D Show helices and sheets RCSB PDB PDBe
1BMW contains 0 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 16 | 1 | 1 |
| β-strand | 19 | 1 | 2 |
| β-strand | 32-33 | 2 | 3 |
| β-strand | 42-43 | 2 | 3 |
| β-strand | 45 | 1 | 4 |
| β-strand | 52 | 1 | 2 |
| β-strand | 53 | 1 | 4 |
| β-strand | 55 | 1 | 1 |
| β-strand | 66 | 1 | 3 |
| β-strand | 69-70 | 2 | 5 |
| β-strand | 74-75 | 2 | 5 |
| β-strand | 78 | 1 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Pollen allergen phl P2 | A | protein | 96 | Phleum pratense | P43214 (AlphaFold model) |
>1BMW_1 POLLEN ALLERGEN PHL P2 (chains A) VPKVTFTVEKGSNEKHLAVLVKYEGDTMAEVELREHGSDEWVAMTKGEGGVWTFDSEEPL QGPFNFRFLTEKGMKNVFDDVVPEKYTIGATYAPEE
An Immunoglobulin-Like Fold in a Major Plant Allergen: The Solution Structure of Phl P 2 from Timothy Grass Pollen. De Marino, S., Morelli, M.A., Fraternali, F. et al. Structure (1999) 7:943-952. DOI 10.1016/S0969-2126(99)80121-X · PubMed
Other PDB entries of the same protein (UniProt P43214 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1BMW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.