1BQ4: Saccharomyces cerevisiae phosphoglycerate mutase

Saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate. Determined by X-ray diffraction at 2.5 Å resolution. Released 26 Aug 1998.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 7,521
Mol. weight: 110.7 kDa
Ligands: BHC
Released: 26 Aug 1998

Explore 1BQ4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BQ4 contains 66 α-helices and 53 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 14 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	11
β-strand	11	1	12
β-strand	18-19	2	13
α-helix	25-26	2
β-strand	27	1	12
α-helix	29-44	16
β-strand	51-54	4	11
α-helix	58-70	13
β-strand	78-80	3	11
α-helix	82-84	3
α-helix	86-88	3
α-helix	90-92	3
β-strand	95-96	2	13
α-helix	97-114	18
α-helix	121-124	4
α-helix	135-137	3
α-helix	142-144	3
α-helix	151-161	11
α-helix	162-166	5
α-helix	167-170	4
β-strand	175-180	6	11
α-helix	182-193	12
β-strand	210-214	5	11
β-strand	215	1	14
β-strand	221	1	14
β-strand	226-227	2	11

Chain B: 18 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	15
β-strand	11	1	16
α-helix	12-14	3
β-strand	18	1	17
α-helix	25-26	2
β-strand	27	1	16
α-helix	28	1
α-helix	29-44	16
β-strand	51-54	4	15
α-helix	58-71	14
β-strand	78-80	3	15
α-helix	82-84	3
α-helix	86-88	3
α-helix	90-92	3
β-strand	96	1	17
α-helix	97-114	18
α-helix	119-124	6
α-helix	135-137	3
α-helix	142-144	3
α-helix	151-161	11
α-helix	162-166	5
α-helix	167-171	5
β-strand	175-180	6	15
α-helix	182-193	12
α-helix	200-202	3
β-strand	211-214	4	15
β-strand	215	1	18
β-strand	221	1	18
β-strand	226-227	2	15
α-helix	230-233	4

Chain C: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	6
β-strand	11	1	7
β-strand	18	1	8
β-strand	19	1	9
α-helix	25-26	2
β-strand	27	1	7
α-helix	28	1
α-helix	29-44	16
β-strand	51-54	4	6
α-helix	58-71	14
β-strand	78-80	3	6
α-helix	82-84	3
α-helix	86-88	3
α-helix	90-92	3
β-strand	93	1	9
β-strand	96	1	8
α-helix	97-104	8
α-helix	106-114	9
α-helix	119-124	6
α-helix	135-137	3
α-helix	151-161	11
α-helix	162-166	5
α-helix	167-170	4
β-strand	176-180	5	6
α-helix	182-192	11
α-helix	200-202	3
β-strand	207	1	6
β-strand	210-214	5	6
β-strand	215	1	10
β-strand	221	1	10
β-strand	226-227	2	6
α-helix	230-234	5

Chain D: 17 helices, 14 β-strands

Element	Residues	Length	Sheet
β-strand	2-6	5	1
β-strand	11	1	2
α-helix	12-14	3
β-strand	18	1	3
β-strand	19	1	4
α-helix	25-26	2
β-strand	27	1	2
α-helix	31-44	14
β-strand	51-54	4	1
α-helix	58-71	14
β-strand	78-80	3	1
α-helix	82-84	3
α-helix	86-88	3
α-helix	90-92	3
β-strand	93	1	4
β-strand	96	1	3
α-helix	97-104	8
α-helix	106-114	9
α-helix	119-121	3
α-helix	135-137	3
α-helix	142-144	3
α-helix	151-161	11
α-helix	162-166	5
α-helix	167-172	6
β-strand	175-179	5	1
α-helix	182-193	12
α-helix	200-202	3
β-strand	210-214	5	1
β-strand	215	1	5
β-strand	221	1	5
β-strand	226-227	2	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (phosphoglycerate mutase 1)	A, B, C, D	protein	246	Saccharomyces cerevisiae	P00950 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>1BQ4_1 PROTEIN (PHOSPHOGLYCERATE MUTASE 1) (chains A, B, C, D)
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRA
IQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPP
PPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAA
HGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAAV
ANQGKK

Ligands and cofactors

ID	Name	Formula	Copies
BHC	Benzene hexacarboxylic acid	C12 H6 O12	1

Water and common crystallization additives (SO4) are not listed.

Primary citation

Polyanionic inhibitors of phosphoglycerate mutase: combined structural and biochemical analysis. Rigden, D.J., Walter, R.A., Phillips, S.E. et al. J Mol Biol (1999) 289:691-699. DOI 10.1006/jmbi.1999.2848 · PubMed

Other PDB entries of the same protein (UniProt P00950 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1QHF 1.7 Å, Yeast phosphoglycerate mutase-3PG complex structure to 1.7 a
5PGM 2.12 Å, Saccharomyces cerevisiae phosphoglycerate mutase
4PGM 2.3 Å, Saccharomyces cerevisiae phosphoglycerate mutase
1BQ3 2.7 Å, Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate
3PGM 2.8 Å, The structure of yeast phosphoglycerate mutase at 0.28 nm resolution

Browse structure collections

About this viewer

MolViewer shows 1BQ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.