1QHF: Protein

Yeast phosphoglycerate mutase-3PG complex structure to 1.7 a. Determined by X-ray diffraction at 1.7 Å resolution. Released 10 Jun 1999.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Saccharomyces cerevisiae
Chains: 2
Atoms: 4,107
Mol. weight: 54.53 kDa
Ligands: 3PG
Released: 10 Jun 1999

Explore 1QHF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QHF contains 33 α-helices and 24 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	1
β-strand	11	1	2
α-helix	12-15	4
β-strand	18	1	3
α-helix	25-26	2
β-strand	27	1	2
α-helix	29-44	16
β-strand	51-54	4	1
α-helix	58-70	13
β-strand	78-80	3	1
α-helix	82-84	3
α-helix	86-88	3
α-helix	90-92	3
β-strand	96	1	3
α-helix	97-114	18
α-helix	119-124	6
α-helix	135-137	3
α-helix	142-144	3
α-helix	151-161	11
α-helix	162-166	5
α-helix	167-171	5
α-helix	174-175	2
β-strand	176-180	5	1
α-helix	182-193	12
α-helix	200-202	3
β-strand	211-214	4	1
β-strand	215	1	4
β-strand	221	1	4
β-strand	226-227	2	1

Chain B: 16 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	5
β-strand	11	1	6
α-helix	12-15	4
β-strand	18	1	7
α-helix	25-26	2
β-strand	27	1	6
α-helix	29-44	16
β-strand	51-54	4	5
α-helix	58-70	13
β-strand	78-80	3	5
α-helix	82-84	3
α-helix	86-88	3
α-helix	90-92	3
β-strand	96	1	7
α-helix	97-114	18
α-helix	119-124	6
α-helix	135-137	3
α-helix	142-144	3
α-helix	151-161	11
α-helix	162-166	5
α-helix	167-171	5
β-strand	176-180	5	5
α-helix	182-193	12
α-helix	199-202	4
β-strand	211-214	4	5
β-strand	215	1	8
β-strand	221	1	8
β-strand	226-227	2	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (phosphoglycerate mutase)	A, B	protein	240	Saccharomyces cerevisiae	P00950 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>1QHF_1 PROTEIN (PHOSPHOGLYCERATE MUTASE) (chains A, B)
PKLVLVRHGQSEWNEKNLFTGWVDVKLSAKGQQEAARAGELLKEKKVYPDVLYTSKLSRA
IQTANIALEKADRLWIPVNRSWRLNERHYGDLQGKDKAETLKKFGEEKFNTYRRSFDVPP
PPIDASSPFSQKGDERYKYVDPNVLPETESLALVIDRLLPYWQDVIAKDLLSGKTVMIAA
HGNSLRGLVKHLEGISDADIAKLNIPTGIPLVFELDENLKPSKPSYYLDPEAAAAGAAAV

Ligands and cofactors

ID	Name	Formula	Copies
3PG	3-phosphoglyceric acid	C3 H7 O7 P	2

Water and common crystallization additives (SO4) are not listed.

Primary citation

Structure of a phosphoglycerate mutase:3-phosphoglyceric acid complex at 1.7 A. Crowhurst, G.S., Dalby, A.R., Isupov, M.N. et al. Acta Crystallogr D Biol Crystallogr (1999) 55:1822-1826. DOI 10.1107/S0907444999009944 · PubMed

Other PDB entries of the same protein (UniProt P00950 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5PGM 2.12 Å, Saccharomyces cerevisiae phosphoglycerate mutase
4PGM 2.3 Å, Saccharomyces cerevisiae phosphoglycerate mutase
1BQ4 2.5 Å, Saccharomyces cerevisiae phosphoglycerate mutase in complex with benzene hexacarboxylate
1BQ3 2.7 Å, Saccharomyces cerevisiae phosphoglycerate mutase in complex with inositol hexakisphosphate
3PGM 2.8 Å, The structure of yeast phosphoglycerate mutase at 0.28 nm resolution

Browse more

1QHF is part of these collections:

Metabolism and cellular energy

About this viewer

MolViewer shows 1QHF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.