1BRT: Bromoperoxidase A2 mutant M99T

Bromoperoxidase A2 mutant M99T. Determined by X-ray diffraction at 1.5 Å resolution. Released 17 Jun 1998.

Method: X-ray diffraction
Resolution: 1.5 Å
Organism: Streptomyces aureofaciens
Chains: 1
Atoms: 2,393
Mol. weight: 30.28 kDa
Released: 17 Jun 1998

Explore 1BRT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BRT contains 17 α-helices and 15 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 17 helices, 15 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	11-16	6	1
β-strand	17-20	4	2
β-strand	25-29	5	2
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	2
α-helix	57-58	2
α-helix	73-87	15
β-strand	92-97	6	2
α-helix	98-100	3
α-helix	101-111	11
β-strand	116-122	7	2
β-strand	130	1	3
β-strand	132	1	4
β-strand	135	1	4
β-strand	140	1	3
α-helix	142-154	13
α-helix	156-167	12
α-helix	170-173	4
β-strand	174	1	5
β-strand	178	1	5
α-helix	180-192	13
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	2
α-helix	233-235	3
α-helix	237-243	7
β-strand	248-252	5	2
α-helix	259-262	4
α-helix	264-276	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Bromoperoxidase A2	A	protein	277	Streptomyces aureofaciens	P29715 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BRT_1 BROMOPEROXIDASE A2 (chains A)
PFITVGQENSTSIDLYYEDHGTGQPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRRG
FGQSSQPTTGYDYDTFAADLNTVLETLDLQDAVLVGFSTGTGEVARYVSSYGTARIAKVA
FLASLEPFLLKTDDNPDGAAPQEFFDGIVAAVKADRYAFYTGFFNDFYNLDENLGTRISE
EAVRNSWNTAASGGFFAAAAAPTTWYTDFRADIPRIDVPALILHGTGDRTLPIENTARVF
HKALPSAEYVEVEGAPHGLLWTHAEEVNTALLAFLAK

Primary citation

Structural investigation of the cofactor-free chloroperoxidases. Hofmann, B., Tolzer, S., Pelletier, I. et al. J Mol Biol (1998) 279:889-900. DOI 10.1006/jmbi.1998.1802 · PubMed

Other PDB entries of the same protein (UniProt P29715 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1BRO 2.05 Å, Bromoperoxidase A2
3VDX 3.0 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains
4IQ4 3.5 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains,…
4ITV 3.6 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains,…
4D9J 3.92 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains
4QES 4.19 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains,…
4QF0 6.49 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains,…
4IVJ 7.35 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains,…
4QFF 7.81 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains,…

Browse structure collections

About this viewer

MolViewer shows 1BRT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.