4IQ4: PDB entry 4IQ4

Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains, triple mutant, P21212 form. Determined by X-ray diffraction at 3.5 Å resolution. Released 24 Jul 2013.

Method: X-ray diffraction
Resolution: 3.5 Å
Organisms: Streptomyces aureofaciens, Influenza A virus
Chains: 6
Atoms: 20,388
Mol. weight: 301.69 kDa
Released: 24 Jul 2013

Explore 4IQ4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

4IQ4 contains 151 α-helices and 78 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 25 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	1
β-strand	11-16	6	1
β-strand	17-20	4	2
β-strand	25-29	5	2
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	2
α-helix	57-58	2
α-helix	73-86	14
β-strand	92-97	6	2
α-helix	100-111	12
β-strand	116-122	7	2
β-strand	130	1	3
β-strand	140	1	3
α-helix	142-154	13
α-helix	156-167	12
α-helix	170-173	4
β-strand	174	1	4
β-strand	178	1	4
α-helix	180-191	12
α-helix	195-200	6
α-helix	202-205	4
α-helix	213-215	3
β-strand	220-225	6	2
α-helix	237-243	7
β-strand	248-252	5	2
α-helix	259-262	4
α-helix	264-295	32
α-helix	299	1
α-helix	302-316	15
α-helix	323-330	8
α-helix	337-350	14
α-helix	361-367	7
α-helix	369-371	3
α-helix	373-388	16
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-439	17

Chain B: 25 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	5
β-strand	11-16	6	5
β-strand	17-20	4	6
β-strand	25-29	5	6
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	6
α-helix	57-58	2
α-helix	73-86	14
β-strand	92-97	6	6
α-helix	100-111	12
β-strand	116-122	7	6
β-strand	130	1	7
β-strand	140	1	7
α-helix	142-154	13
α-helix	156-167	12
α-helix	170-173	4
β-strand	174	1	8
β-strand	178	1	8
α-helix	180-191	12
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	6
α-helix	233-235	3
α-helix	237-243	7
β-strand	248-252	5	6
α-helix	259-262	4
α-helix	264-297	34
α-helix	299	1
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	361-367	7
α-helix	377-388	12
α-helix	392-399	8
α-helix	404-416	13
α-helix	423-439	17

Chain C: 25 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	9
β-strand	11-16	6	9
β-strand	17-20	4	10
β-strand	25-29	5	10
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	10
α-helix	57-58	2
α-helix	73-86	14
β-strand	92-97	6	10
α-helix	100-111	12
β-strand	116-122	7	10
β-strand	130	1	11
β-strand	140	1	11
α-helix	142-154	13
α-helix	156-167	12
α-helix	170-173	4
β-strand	174	1	12
β-strand	178	1	12
α-helix	180-191	12
α-helix	195-200	6
α-helix	202-205	4
α-helix	213-215	3
β-strand	220-225	6	10
α-helix	233-235	3
α-helix	237-243	7
β-strand	248-252	5	10
α-helix	259-262	4
α-helix	264-297	34
α-helix	299	1
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	361-368	8
α-helix	373-388	16
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-439	17

Chain D: 26 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	13
β-strand	11-16	6	13
β-strand	17-20	4	14
β-strand	25-29	5	14
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	14
α-helix	57-58	2
α-helix	73-86	14
β-strand	92-97	6	14
α-helix	100-111	12
β-strand	116-122	7	14
β-strand	130	1	15
β-strand	140	1	15
α-helix	142-154	13
α-helix	156-167	12
α-helix	170-173	4
β-strand	174	1	16
β-strand	178	1	16
α-helix	180-192	13
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	14
α-helix	233-235	3
α-helix	237-243	7
β-strand	248-252	5	14
α-helix	259-262	4
α-helix	264-297	34
α-helix	299	1
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	361-367	7
α-helix	369-371	3
α-helix	373-388	16
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-439	17

Chain E: 25 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	17
β-strand	11-16	6	17
β-strand	17-20	4	18
β-strand	25-29	5	18
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	18
α-helix	57-58	2
α-helix	73-86	14
β-strand	92-97	6	18
α-helix	100-111	12
β-strand	116-122	7	18
β-strand	130	1	19
β-strand	140	1	19
α-helix	142-154	13
α-helix	156-167	12
α-helix	170-173	4
β-strand	174	1	20
β-strand	178	1	20
α-helix	180-192	13
α-helix	195-200	6
α-helix	201-204	4
α-helix	213-215	3
β-strand	220-225	6	18
α-helix	233-235	3
α-helix	237-243	7
β-strand	248-252	5	18
α-helix	259-262	4
α-helix	264-297	34
α-helix	299	1
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	361-367	7
α-helix	373-388	16
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-439	17

Chain F: 25 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	21
β-strand	11-16	6	21
β-strand	17-20	4	22
β-strand	25-29	5	22
α-helix	36-39	4
α-helix	40-48	9
β-strand	52-56	5	22
α-helix	57-58	2
α-helix	73-86	14
β-strand	92-97	6	22
α-helix	99-111	13
β-strand	116-122	7	22
β-strand	130	1	23
β-strand	140	1	23
α-helix	142-154	13
α-helix	156-167	12
α-helix	170-173	4
β-strand	174	1	24
β-strand	178	1	24
α-helix	180-191	12
α-helix	195-200	6
α-helix	202-205	4
α-helix	213-215	3
β-strand	220-225	6	22
α-helix	233-235	3
α-helix	237-243	7
β-strand	248-252	5	22
α-helix	259-262	4
α-helix	264-297	34
α-helix	299	1
α-helix	302-316	15
α-helix	322-330	9
α-helix	337-350	14
α-helix	361-368	8
α-helix	373-388	16
α-helix	392-399	8
α-helix	404-415	12
α-helix	423-438	16

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Non-haem bromoperoxidase BPO-A2, Matrix protein 1	A, B, C, D, E, F	protein	456	Streptomyces aureofaciens, Influenza A virus	P03485 (AlphaFold model), P29715 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>4IQ4_1 Non-haem bromoperoxidase BPO-A2, Matrix protein 1 (chains A, B, C, D, E, F)
MPFITVGQENSTSIDLYYEDHGTGTPVVLIHGFPLSGHSWERQSAALLDAGYRVITYDRR
GFGQSSQPTTGYDYDTFAADLNTVLETLDLQDAVLVGFSMGTGEVARYVSSYGTARIAAV
AFLASLEPFLLKTDDNPDGAAPQEFFDGIVAAVKADRYAFYTGFFNDFYNLDENLGTRIS
EEAVRNSWNTAASGGFFAAAAAPTTWYTDFRADIPRIDVPALILHGTGDRTLPIENTARV
FHKALPSAEYVEVEGAPHGLLWTHAEEVNTALLAFLAKAQEAQKQKLLTEVETYVLSIIP
SGPLKAEIAQRLEDVFAGKNTDLEVLMEWLKTRPILSPLTKGILGFVFTLTVPSERGLQR
RRFVQNALNGNGDPNNMDKAVKLYRKLKREITFHGAKEISLSYSAGALASCMGLIYNRMG
AVTTEVAFGLVCATCEQIADSQHRSHRQLEHHHHHH

Primary citation

Structure and flexibility of nanoscale protein cages designed by symmetric self-assembly. Lai, Y.T., Tsai, K.L., Sawaya, M.R. et al. J Am Chem Soc (2013) 135:7738-7743. DOI 10.1021/ja402277f · PubMed

Other PDB entries of the same protein (UniProt P03485 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2VLL 1.6 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5TEZ 1.7 Å, TCR F50 recgonizing M1-HLA-A2
5ISZ 2.06 Å, Crystal structure of LS01-TCR/M1-HLA-A*02 complex
1AA7 2.08 Å, Influenza virus matrix protein crystal structure at PH 4.0
5CQE 2.1 Å, 2.1 Angstrom resolution crystal structure of matrix protein 1 (M1; residues 1-164) from…
5EUO 2.1 Å, PF6-M1-HLA-A2
1EA3 2.3 Å, Influenza virus M1 protein
2VLR 2.3 Å, The Structural Dynamics and Energetics of an Immunodominant T-cell Receptor are…
5JHD 2.46 Å, Crystal structure of LS10-TCR/M1-HLA-A*02 complex
1HHI 2.5 Å, The antigenic identity of peptide(slash)mhc complexes: a comparison of the conformation…
3VDX 3.0 Å, Structure of a 16 nm protein cage designed by fusing symmetric oligomeric domains
7JM3 3.4 Å, Full-length three-dimensional structure of the influenza A virus M1 protein and its…

Browse structure collections

About this viewer

MolViewer shows 4IQ4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.