1BW6: Protein

Human centromere protein B (cenp-B) DNA bindign domain RP1. Determined by solution NMR. Released 7 Oct 1998.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 459
Mol. weight: 6.55 kDa
Released: 7 Oct 1998

Explore 1BW6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1BW6 contains 4 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	10-21	12
α-helix	28-35	8
α-helix	41-47	7
α-helix	49-52	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (centromere protein B)	A	protein	56	Homo sapiens	P07199 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1BW6_1 PROTEIN (CENTROMERE PROTEIN B) (chains A)
MGPKRRQLTFREKSRIIQEVEENPDLRKGEIARRFNIPPSTLSTILKNKRAILASE

Primary citation

A helix-turn-helix structure unit in human centromere protein B (CENP-B). Iwahara, J., Kigawa, T., Kitagawa, K. et al. EMBO J (1998) 17:827-837. DOI 10.1093/emboj/17.3.827 · PubMed

Other PDB entries of the same protein (UniProt P07199 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1UFI 1.65 Å, Crystal structure of the dimerization domain of human CENP-B
6KDR 2.11 Å, Crystal structure of human NRMT2 in complex with human centromere protein B peptide
1HLV 2.5 Å, Crystal structure of cenp-B(1-129) complexed with the cenp-B box DNA

Browse structure collections

About this viewer

MolViewer shows 1BW6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.