1C12: Protein

Insight in odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide. Determined by X-ray diffraction at 2.6 Å resolution. Released 14 Aug 1999.

Method: X-ray diffraction
Resolution: 2.6 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,459
Mol. weight: 47.55 kDa
Ligands: TRZ
Released: 14 Aug 1999

Explore 1C12 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1C12 contains 15 α-helices and 46 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	44-49	6	2
β-strand	53-54	2	2
α-helix	55L	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96L	1
β-strand	97-98L	2	2
β-strand	102-106	5	2
α-helix	107	1
β-strand	111	1	3
α-helix	112-113	2
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-155	3	5
β-strand	159-163	5	4
β-strand	173-182	10	4
α-helix	183-186	4
β-strand	191-197	7	5
β-strand	205-210	6	5

Chain B: 7 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	303-307	5	6
β-strand	311-312	2	7
β-strand	318-325	8	6
β-strand	334-339	6	8
β-strand	345-351	7	8
β-strand	357-359	3	8
α-helix	361-363	3
β-strand	367-372	6	6
α-helix	373-375	3
β-strand	377-382	6	6
α-helix	384-386	3
β-strand	388-394	7	8
β-strand	397	1	9
β-strand	400D	1	9
β-strand	103H	1	8
β-strand	407-409	3	8
β-strand	410-411	2	7
α-helix	414-416	3
β-strand	417	1	10
β-strand	420-424	5	11
β-strand	435-445	11	11
β-strand	446	1	10
β-strand	451-454	4	12
β-strand	459	1	12
β-strand	463-465	3	11
α-helix	466-468	3
β-strand	469-471	3	11
β-strand	474-484	11	11
α-helix	487-490	4
β-strand	494-499	6	12
α-helix	500-502	3
β-strand	504-509	6	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (antibody fragment FAB)	A	protein	214	Mus musculus	P01837 (AlphaFold model)
Protein (antibody fragment FAB)	B	protein	220	Mus musculus	P01869 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1C12_1 PROTEIN (ANTIBODY FRAGMENT FAB) (chains A)
DIELTQSPSSMSVSLGDTVSITCHASQGISSNIGWLQQKPGKSFKGLIYHGTNLEDGVPS
RFSGSGSGADYSLTISSLESEDFADYYCVQYVQFPFTFGSGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEA

Sequence of entity 2 (B), FASTA

>1C12_2 PROTEIN (ANTIBODY FRAGMENT FAB) (chains B)
QVQLQESGPGLVKPSQSLSLTCTVTGYSITSDYAWNWIRQFPGNKLEWMGYISYSGSTSY
SPSLKSRISLTRDTSKNQFFLQLNSVTTEDTATYYCVTSLTWLLRRKRSYWGQGTTVTVS
SASTKGPSVYPLAPGSKAAASMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPE

Ligands and cofactors

ID	Name	Formula	Copies
TRZ	Trazeolide	C20 H28 O3	1

Primary citation

Insight into odorant perception: the crystal structure and binding characteristics of antibody fragments directed against the musk odorant traseolide. Langedijk, A.C., Spinelli, S., Anguille, C. et al. J Mol Biol (1999) 292:855-869. DOI 10.1006/jmbi.1999.3101 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1C12 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.