1CA4: Tnf receptor associated factor 2

Structure of tnf receptor associated factor 2 (TRAF2). Determined by X-ray diffraction at 2.2 Å resolution. Released 12 Apr 1999.

Method: X-ray diffraction
Resolution: 2.2 Å
Organism: Homo sapiens
Chains: 6
Atoms: 8,435
Mol. weight: 114.04 kDa
Released: 12 Apr 1999

Explore 1CA4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CA4 contains 47 α-helices and 63 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, C and F: 8 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	335-347	13
β-strand	353-359	7	1
α-helix	361-369	9
β-strand	376-377	2	2
α-helix	378-380	3
β-strand	381-382	2	2
β-strand	389-395	7	2
α-helix	400-402	3
β-strand	406-414	9	2
α-helix	419-421	3
β-strand	430-434	5	1
β-strand	443-447	5	1
α-helix	454-456	3
α-helix	458-459	2
β-strand	463	1	2
α-helix	464-466	3
β-strand	467-474	8	2
β-strand	486	1	1
β-strand	489-496	8	1

Chain B: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	335-347	13
β-strand	353-359	7	3
α-helix	361-369	9
β-strand	376-377	2	4
α-helix	378-380	3
β-strand	381-382	2	4
β-strand	389-395	7	4
α-helix	400-402	3
β-strand	406-414	9	4
α-helix	419-421	3
β-strand	430-434	5	3
β-strand	443-447	5	3
α-helix	454-456	3
α-helix	458-459	2
β-strand	463	1	4
α-helix	464-466	3
β-strand	467-474	8	4
β-strand	489-496	8	3

Chain D: 8 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	335-347	13
β-strand	353-359	7	7
α-helix	361-369	9
β-strand	375-377	3	8
α-helix	378-380	3
β-strand	381-382	2	8
β-strand	389-395	7	8
α-helix	400-402	3
β-strand	406-414	9	8
α-helix	419-421	3
β-strand	430-434	5	7
β-strand	443-447	5	7
α-helix	454-456	3
α-helix	458-459	2
β-strand	463	1	8
α-helix	464-466	3
β-strand	467-474	8	8
β-strand	489-496	8	7

Chain E: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
α-helix	335-347	13
β-strand	353-359	7	9
α-helix	361-369	9
β-strand	376-377	2	10
α-helix	378-380	3
β-strand	381-382	2	10
β-strand	389-395	7	10
α-helix	400-402	3
β-strand	406-414	9	10
α-helix	419-421	3
β-strand	430-434	5	9
β-strand	443-447	5	9
α-helix	458-459	2
β-strand	463	1	10
α-helix	464-466	3
β-strand	467-474	8	10
β-strand	489-496	8	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (tnf receptor associated factor 2)	A, B, C, D, E, F	protein	168	Homo sapiens	Q12933 (AlphaFold model)

Sequence of entity 1 (A, B, C, D, E, F), FASTA

>1CA4_1 PROTEIN (TNF RECEPTOR ASSOCIATED FACTOR 2) (chains A, B, C, D, E, F)
AMADLEQKVLEMEASTYDGVFIWKISDFARKRQEAVAGRIPAIFSPAFYTSRYGYKMCLR
IYLNGDGTGRGTHLSLFFVVMKGPNDALLRWPFNQKVTLMLLDQNNREHVIDAFRPDVTS
SSFQRPVNDMNIASGCPLFCPVSKMEAKNSYVRDDAIFIKAIVDLTGL

Primary citation

Structural basis for self-association and receptor recognition of human TRAF2. Park, Y.C., Burkitt, V., Villa, A.R. et al. Nature (1999) 398:533-538. DOI 10.1038/19110 · PubMed

Other PDB entries of the same protein (UniProt Q12933 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3KNV 1.9 Å, Crystal structure of the RING and first zinc finger domains of TRAF2
8T5Q 1.9 Å, SARS-CoV-2 ORF3a peptide in complex with TRAF2 TRAF domain
1CZY 2.0 Å, Crystal structure of the complex between the traf domain of human TRAF2 and an LMP1…
1D00 2.0 Å, Structure of tnf receptor associated factor 2 in complex with a 5-residue CD40 peptide
1D01 2.0 Å, Structure of tnf receptor associated factor 2 in complex with a human CD30 peptide
1D0A 2.0 Å, Structure of tnf receptor associated factor 2 (TRAF2) in complex with a human OX40 peptide
1F3V 2.0 Å, Crystal structure of the complex between the N-terminal domain of TRADD and the TRAF…
1CA9 2.3 Å, Structure of tnf receptor associated factor 2 in complex with a peptide from tnf-R2
1QSC 2.4 Å, Crystal structure of the traf domain of TRAF2 in a complex with a peptide from the CD40…
1D0J 2.5 Å, Structure of tnf receptor associated factor 2 in complex with a M4-1BB peptide
3M0A 2.61 Å, Crystal structure of TRAF2:cIAP2 complex
3M06 2.67 Å, Crystal Structure of TRAF2

Browse structure collections

About this viewer

MolViewer shows 1CA4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.