Camp-dependent protein kinase catalytic subunit (E.C.2.7.1.37) (protein kinase A) complexed with protein kinase inhibitor peptide fragment 5-24 (PKI(5-24) isoelectric variant ca) and MN2+ adenylyl imidodiphosphate (mnamp-pnp) at PH 5.6 and 7C and 4C. Determined by X-ray diffraction at 2.0 Å resolution. Released 15 Oct 1995.
Explore 1CDK in 3D Show helices and sheets RCSB PDB PDBe
1CDK contains 40 α-helices and 26 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 10-31 | 22 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-51 | 9 | 1 |
| β-strand | 56-62 | 7 | 1 |
| β-strand | 68-75 | 8 | 1 |
| α-helix | 76-81 | 6 | |
| α-helix | 85-97 | 13 | |
| β-strand | 103 | 1 | 2 |
| β-strand | 106-111 | 6 | 1 |
| β-strand | 115-120 | 6 | 1 |
| α-helix | 121-122 | 2 | |
| β-strand | 127 | 1 | 2 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 3 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 2 |
| β-strand | 180-182 | 3 | 2 |
| β-strand | 189-190 | 2 | 3 |
| β-strand | 195 | 1 | 4 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-210 | 4 | |
| β-strand | 215 | 1 | 4 |
| α-helix | 219-233 | 15 | |
| α-helix | 243-252 | 10 | |
| α-helix | 263-272 | 10 | |
| α-helix | 289-292 | 4 | |
| α-helix | 295-297 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 311-312 | 2 | |
| α-helix | 331-334 | 4 | |
| α-helix | 345-347 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 9-31 | 23 | |
| α-helix | 40-42 | 3 | |
| β-strand | 43-51 | 9 | 5 |
| β-strand | 56-62 | 7 | 5 |
| β-strand | 68-75 | 8 | 5 |
| α-helix | 76-81 | 6 | |
| α-helix | 85-97 | 13 | |
| β-strand | 103 | 1 | 6 |
| β-strand | 106-111 | 6 | 5 |
| β-strand | 115-120 | 6 | 5 |
| β-strand | 127 | 1 | 6 |
| α-helix | 128-135 | 8 | |
| α-helix | 140-159 | 20 | |
| β-strand | 162-163 | 2 | 7 |
| α-helix | 169-171 | 3 | |
| β-strand | 172-174 | 3 | 6 |
| β-strand | 180-182 | 3 | 6 |
| β-strand | 189-190 | 2 | 7 |
| β-strand | 195 | 1 | 8 |
| α-helix | 202-204 | 3 | |
| α-helix | 207-211 | 5 | |
| β-strand | 215 | 1 | 8 |
| α-helix | 218-233 | 16 | |
| α-helix | 243-252 | 10 | |
| α-helix | 256-258 | 3 | |
| α-helix | 263-272 | 10 | |
| α-helix | 289-292 | 4 | |
| α-helix | 295-297 | 3 | |
| α-helix | 302-306 | 5 | |
| α-helix | 315-317 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-7 | 6 | |
| α-helix | 16-18 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 2-8 | 7 | |
| α-helix | 14-18 | 5 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Camp-dependent protein kinase | A, B | protein | 350 | Sus scrofa | P36887 (AlphaFold model) |
| Protein kinase inhibitor | I, J | protein | 20 | Homo sapiens | P61926 (AlphaFold model) |
>1CDK_1 CAMP-DEPENDENT PROTEIN KINASE (chains A, B) GNAAAAKKGSEQESVKEFLAKAKEDFLKKWENPAQNTAHLDQFERIKTLGTGSFGRVMLV KHKETGNHFAMKILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVM EYVPGGEMFSHLRRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYI QVTDFGFAKRVKGRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFA DQPIQIYEKIVSGKVRFPSHFSSDLKDLLRNLLQVDLTKRFGNLKDGVNDIKNHKWFATT DWIAIYQRKVEAPFIPKFKGPGDTSNFDDYEEEEIRVSINEKCGKEFSEF
>1CDK_2 PROTEIN KINASE INHIBITOR (chains I, J) TTYADFIASGRTGRRNAIHD
| ID | Name | Formula | Copies |
|---|---|---|---|
| MYR | Myristic acid | C14 H28 O2 | 2 |
| ANP | Phosphoaminophosphonic acid-adenylate ester | C10 H17 N6 O12 P3 | 2 |
| MN | Manganese (II) ion | Mn | 4 |
Phosphotransferase and substrate binding mechanism of the cAMP-dependent protein kinase catalytic subunit from porcine heart as deduced from the 2.0 A structure of the complex with Mn2+ adenylyl imidodiphosphate and inhibitor peptide PKI(5-24). Bossemeyer, D., Engh, R.A., Kinzel, V. et al. EMBO J (1993) 12:849-859. PubMed
Other PDB entries of the same protein (UniProt P36887 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1CDK directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.