1CFQ: Anti-P24 (HIV-1) FAB fragment CB41

Name: PDB 1CFQ: Anti-P24 (HIV-1) FAB fragment CB41
Published: 1999-03-30
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: polyspecificity

Anti-P24 (HIV-1) FAB fragment CB41. Determined by X-ray diffraction at 2.8 Å resolution. Released 30 Mar 1999.

Method: X-ray diffraction
Resolution: 2.8 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,303
Mol. weight: 46.6 kDa
Released: 30 Mar 1999

Explore 1CFQ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CFQ contains 9 α-helices and 53 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	1
β-strand	7	1	2
β-strand	10-13	4	3
β-strand	19-20	2	4
β-strand	22	1	2
β-strand	23-24	2	5
β-strand	25	1	1
β-strand	33-38	6	3
β-strand	45-48	4	3
β-strand	49	1	6
β-strand	53	1	6
β-strand	62-63	2	4
β-strand	66-67	2	5
β-strand	70-71	2	5
β-strand	74-75	2	4
α-helix	80-82	3
β-strand	84-90	7	3
α-helix	96	1
β-strand	97-98	2	3
β-strand	102-106	5	3
β-strand	111	1	7
β-strand	114-118	5	8
α-helix	119-121	3
α-helix	122-125	4
β-strand	129-139	11	8
β-strand	140	1	7
β-strand	145-150	6	9
β-strand	153-155	3	9
β-strand	159-163	5	8
β-strand	173-182	10	8
α-helix	183-188	6
β-strand	191-198	8	9
β-strand	201-210	10	9

Chain B: 4 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	4-6	3	10
α-helix	7-9	3
β-strand	10-12	3	11
β-strand	18-24	7	10
β-strand	34-40	7	11
β-strand	44-51	8	11
β-strand	59-60	2	11
α-helix	62-64	3
β-strand	65	1	12
β-strand	68	1	12
β-strand	70-73	4	10
β-strand	78-83	6	10
α-helix	88-90	3
β-strand	92-97	6	11
β-strand	101	1	3
β-strand	102	1	11
β-strand	106-110	5	11
β-strand	116	1	13
β-strand	119-123	5	14
β-strand	134-144	11	14
β-strand	145	1	13
β-strand	150-153	4	15
β-strand	158	1	15
β-strand	162-164	3	14
β-strand	168-169	2	14
β-strand	174-183	10	14
β-strand	193-198	6	15
β-strand	203-208	6	15
α-helix	210-212	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (IGG2A kappa antibody CB41 (light chain))	A	protein	214	Mus musculus	P01837 (AlphaFold model)
Protein (IGG2A kappa antibody CB41 (heavy chain))	B	protein	213	Mus musculus	P01864 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CFQ_1 PROTEIN (IGG2A KAPPA ANTIBODY CB41 (LIGHT CHAIN)) (chains A)
DIKMTQSPSSMYTSLGERVTITCKASQDINSFLTWFLQKPGKSPKTLIYRANRLMIGVPS
RFSGSGSGQTYSLTISSLEYEDMGIYYCLQYDDFPLTFGAGTKLDLKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKEINVKWKIDGSERQNGVLDSWTEQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B), FASTA

>1CFQ_2 PROTEIN (IGG2A KAPPA ANTIBODY CB41 (HEAVY CHAIN)) (chains B)
QDQLQQSGAELVRPGASVKLSCKALGYIFTDYEIHWVKQTPVHGLEWIGGIHPGSSGTAY
NQKFKGKATLTADKSSTTAFMELSSLTSEDSAVYYCTRKDYWGQGTLVTVSAAKTTAPSV
YPLVPVCGGTTGSSVTLGCLVKGYFPEPVTLTWNSGSLSSGVHTFPALLQSGLYTLSSSV
TVTSNTWPSQTITCNVAHPASSTKVDKKIEPRV

Primary citation

Crystallographic analysis of anti-p24 (HIV-1) monoclonal antibody cross-reactivity and polyspecificity. Keitel, T., Kramer, A., Wessner, H. et al. Cell (1997) 91:811-820. DOI 10.1016/S0092-8674(00)80469-9 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1CFQ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.