Glycan-free mutant adhesion domain of human CD58 (lfa-3). Determined by solution NMR. Released 22 Jun 1999.
Explore 1CI5 in 3D Show helices and sheets RCSB PDB PDBe
1CI5 contains 1 α-helix and 11 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-8 | 6 | 1 |
| β-strand | 9 | 1 | 2 |
| β-strand | 12-15 | 4 | 3 |
| β-strand | 26-30 | 5 | 1 |
| β-strand | 33-39 | 7 | 1 |
| β-strand | 42-45 | 4 | 1 |
| α-helix | 49-52 | 4 | |
| β-strand | 53-55 | 3 | 3 |
| β-strand | 62-65 | 4 | 3 |
| β-strand | 67 | 1 | 2 |
| β-strand | 74-78 | 5 | 1 |
| β-strand | 85-93 | 9 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protein (lymphocyte function-associated antigen 3(CD58)) | A | protein | 95 | Homo sapiens | P19256 (AlphaFold model) |
>1CI5_1 PROTEIN (LYMPHOCYTE FUNCTION-ASSOCIATED ANTIGEN 3(CD58)) (chains A) SSQQIYGVKYGNVTFHVPSNQPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTKSG SLTIYNLTSSDEDEYEMESPNITDSMKFFLYVGES
Functional glycan-free adhesion domain of human cell surface receptor CD58: design, production and NMR studies. Sun, Z.Y., Dotsch, V., Kim, M. et al. EMBO J (1999) 18:2941-2949. DOI 10.1093/emboj/18.11.2941 · PubMed
Other PDB entries of the same protein (UniProt P19256 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1CI5 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.