1QA9: Human CD2 protein

Structure of a Heterophilic Adhesion Complex Between the Human CD2 and CD58(LFA-3) Counter-Receptors. Determined by X-ray diffraction at 3.2 Å resolution. Released 29 Apr 1999.

Method: X-ray diffraction
Resolution: 3.2 Å
Organism: Homo sapiens
Chains: 4
Atoms: 3,244
Mol. weight: 46.04 kDa
Released: 29 Apr 1999

Explore 1QA9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1QA9 contains 2 α-helices and 39 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	7-12	6	1
β-strand	17-19	3	2
β-strand	30-37	8	1
β-strand	45-48	4	1
β-strand	54-55	2	1
β-strand	60-63	4	2
β-strand	67-70	4	2
β-strand	80-87	8	1
β-strand	92-103	12	1

Chain B: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-8	6	3
β-strand	13-15	3	4
β-strand	26-30	5	3
β-strand	33-38	6	3
β-strand	43-45	3	3
α-helix	47-49	3
β-strand	53-55	3	4
β-strand	62-64	3	4
β-strand	74-78	5	3
β-strand	86-93	8	3

Chain C: 0 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	8-12	5	5
β-strand	17-19	3	6
β-strand	30-37	8	5
β-strand	43-48	6	5
β-strand	53-55	3	5
β-strand	60-63	4	6
β-strand	67-70	4	6
β-strand	80-87	8	5
β-strand	92-103	12	5

Chain D: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-8	7	7
β-strand	12-15	4	8
β-strand	25	1	9
β-strand	27-29	3	7
β-strand	34-36	3	7
β-strand	39	1	9
β-strand	42	1	9
β-strand	45	1	7
α-helix	47-49	3
β-strand	53-55	3	8
β-strand	62-65	4	8
β-strand	74-78	5	7
β-strand	87-93	7	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Human CD2 protein	A, C	protein	102	Homo sapiens	P06729 (AlphaFold model)
Human CD58 protein	B, D	protein	95	Homo sapiens	P19256 (AlphaFold model)

Sequence of entity 1 (A, C), FASTA

>1QA9_1 HUMAN CD2 PROTEIN (chains A, C)
TNALETWGALGQDINLDIPSFQMSDDIDDIKWEKTSDKKKIAQFRKEKETFKEKDTYELL
KNGALKIKHLKTDDQDIYKVSIYDTKGKNVLEKIFDLKIQER

Sequence of entity 2 (B, D), FASTA

>1QA9_2 HUMAN CD58 PROTEIN (chains B, D)
SSQQIYGVKYGNVTFHVPSNQPLKEVLWKKQKDKVAELENSEFRAFSSFKNRVYLDTKSG
SLTIYNLTSSDEDEYEMESPNITDSMKFFLYVGES

Primary citation

Structure of a heterophilic adhesion complex between the human CD2 and CD58 (LFA-3) counterreceptors. Wang, J.H., Smolyar, A., Tan, K. et al. Cell (1999) 97:791-803. DOI 10.1016/S0092-8674(00)80790-4 · PubMed

Other PDB entries of the same protein (UniProt P06729 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2J6O 2.23 Å, Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterotrimer
1HNF 2.5 Å, Crystal structure of the extracellular region of the human cell adhesion molecule CD2 at…
2J7I 2.9 Å, Atypical polyproline recognition by the cms N-terminal SH3 domain. CMS:CD2 heterodimer
1CDB Structure of the glycosylated adhesion domain of human T lymphocyte glycoprotein CD2
1GYA N-glycan and polypeptide NMR solution structures of the adhesion domain of human CD2
1L2Z CD2BP2-GYF domain in complex with proline-rich CD2 tail segment peptide

Browse structure collections

About this viewer

MolViewer shows 1QA9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.