1CI6: Transcription factor atf-4

Name: PDB 1CI6: Transcription factor ATF4-c/ebp beta bzip heterodimer
Published: 2000-12-04
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: transcription

Transcription factor ATF4-c/ebp beta bzip heterodimer. Determined by X-ray diffraction at 2.6 Å resolution. Released 4 Dec 2000.

Method: X-ray diffraction
Resolution: 2.6 Å
Organisms: Homo sapiens, Mus musculus
Chains: 2
Atoms: 933
Mol. weight: 15.46 kDa
Ligands: FE
Released: 4 Dec 2000

Explore 1CI6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CI6 contains 2 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	288-340	53

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	240-282	43

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Transcription factor atf-4	A	protein	63	Homo sapiens	P18848 (AlphaFold model)
Transcription factor c/ebp beta	B	protein	63	Mus musculus	P28033 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CI6_1 TRANSCRIPTION FACTOR ATF-4 (chains A)
MKKLKKMEQNKTAATRYRQKKRAEQEALTGECKELEKKNEALKERADSLAKEIQYLKDLI
EEV

Sequence of entity 2 (B), FASTA

>1CI6_2 TRANSCRIPTION FACTOR C/EBP BETA (chains B)
MEYKMRRERNNIAVRKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLF
KQL

Ligands and cofactors

ID	Name	Formula	Copies
FE	FE (III) ion	Fe	3

Water and common crystallization additives (BME) are not listed.

Primary citation

Crystal structure of the CCAAT box/enhancer-binding protein beta activating transcription factor-4 basic leucine zipper heterodimer in the absence of DNA. Podust, L.M., Krezel, A.M., Kim, Y. J Biol Chem (2001) 276:505-513. DOI 10.1074/jbc.M005594200 · PubMed

Other PDB entries of the same protein (UniProt P18848 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9TFU 2.0 Å, Crystal structure of beta-TrCP bound by monophosphorylated ATF4 degron peptide

Browse structure collections

About this viewer

MolViewer shows 1CI6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.