9TFU: F-box/WD repeat-containing protein 1A

Crystal structure of beta-TrCP bound by monophosphorylated ATF4 degron peptide. Determined by X-ray diffraction at 2.0 Å resolution. Released 8 Apr 2026.

Method: X-ray diffraction
Resolution: 2.0 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,004
Mol. weight: 43.25 kDa
Released: 8 Apr 2026

Explore 9TFU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9TFU contains 5 α-helices and 28 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 28 β-strands

Element	Residues	Length	Sheet
α-helix	188-199	12
α-helix	201-210	10
α-helix	229-252	24
β-strand	256-261	6	1
β-strand	270-275	6	2
β-strand	279-284	6	2
β-strand	289-293	5	2
β-strand	299-303	5	2
β-strand	310-315	6	3
β-strand	319-324	6	3
β-strand	328-333	6	3
β-strand	339-344	6	3
β-strand	350-356	7	4
β-strand	359-364	6	4
β-strand	368-374	7	4
β-strand	380-387	8	4
β-strand	393-398	6	5
β-strand	402-407	6	5
β-strand	412-416	5	5
β-strand	422-426	5	5
β-strand	433-439	7	6
β-strand	442-447	6	6
β-strand	451-456	6	6
β-strand	461-467	7	6
β-strand	473-478	6	7
β-strand	482-487	6	7
β-strand	491-496	6	7
α-helix	497-500	4
α-helix	507-509	3
β-strand	511-516	6	7
β-strand	522-527	6	1
β-strand	531-536	6	1
β-strand	540-545	6	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
F-box/WD repeat-containing protein 1A	A	protein	365	Homo sapiens	Q9Y297 (AlphaFold model)
Cyclic AMP-dependent transcription factor ATF-4	B	protein	13	Homo sapiens	P18848 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>9TFU_1 F-box/WD repeat-containing protein 1A (chains A)
GSGMEWKKEIERMVRTDSLWRGLAERRGWGQYLFKNKPPDGNAPPNSFYRALYPKIIQDI
ETIESNWRCGRHSLQRIHCRSETSKGVYCLQYDDQKIVSGLRDNTIKIWDKNTLECKRIL
TGHTGSVLCLQYDERVIITGSSDSTVRVWDVNTGEMLNTLIHHCEAVLHLRFNNGMMVTC
SKDRSIAVWDMASPTDITLRRVLVGHRAAVNVVDFDDKYIVSASGDRTIKVWNTSTCEFV
RTLNGHKRGIACLQYRDRLVVSGSSDNTIRLWDIECGACLRVLEGHEELVRCIRFDNKRI
VSGAYDGKIKVWDLVAALDPRAPAGTLCLRTLVEHSGRVFRLQFDEFQIVSSSHDDTILI
WDFLN

Sequence of entity 2 (B), FASTA

>9TFU_2 Cyclic AMP-dependent transcription factor ATF-4 (chains B)
SDNDSGICMSPES

Primary citation

Structural Studies of beta TrCP Reveal Plasticity in Binding Modes of Consensus and Nonconsensus Degrons. Collie, G.W., Mak, H., Acebron-Garcia-de-Eulate, M. et al. ACS Chem Biol (2026) 21:744-750. DOI 10.1021/acschembio.5c01007 · PubMed

Other PDB entries of the same protein (UniProt Q9Y297 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9T9W 1.16 Å, Crystal structure of beta-TrCP bound by diphosphorylated I-kappa-B-alpha degron peptide
9TES 1.22 Å, Crystal structure of beta-TrCP bound by diphosphorylated PDCD4 degron peptide
9TDZ 1.35 Å, Crystal structure of beta-TrCP bound by diphosphorylated claspin degron peptide
9TG7 1.68 Å, Crystal structure of beta-TrCP bound by monophosphorylated WEE1 degron peptide
9T8Y 1.79 Å, Crystal structure of beta-TrCP bound by monophosphorylated NRF2 degron peptide.
6M90 2.05 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2776 ternary complex
9T95 2.15 Å, Crystal structure of beta-TrCP bound by diphosphorylated NRF2 degron peptide.
6M92 2.35 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-2663 ternary complex
6M91 2.4 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-103094 ternary complex
2P64 2.5 Å, D domain of b-TrCP
6M93 2.5 Å, Monophosphorylated pSer33 b-Catenin peptide, b-TrCP/Skp1, NRX-1933 ternary complex
6M94 2.7 Å, Monophosphorylated pSer33 b-Catenin peptide bound to b-TrCP/Skp1 Complex

Browse structure collections

About this viewer

MolViewer shows 9TFU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.