1CIC: Protein

Idiotope-anti-idiotope FAB-FAB complex; D1.3-E225. Determined by X-ray diffraction at 2.5 Å resolution. Released 19 Apr 1999.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 4
Atoms: 6,733
Mol. weight: 94 kDa
Released: 19 Apr 1999

Explore 1CIC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CIC contains 24 α-helices and 85 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-65	4	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	85-90	6	2
α-helix	96	1
β-strand	98	1	2
β-strand	102-106	5	2
α-helix	107	1
β-strand	111	1	3
β-strand	114-118	5	4
α-helix	119-121	3
α-helix	122-126	5
β-strand	129-139	11	4
β-strand	140	1	3
β-strand	145-150	6	5
β-strand	153-154	2	5
β-strand	159-163	5	4
α-helix	164-165	2
β-strand	173-182	10	4
α-helix	183-187	5
β-strand	191-197	7	5
α-helix	204	1
β-strand	205-210	6	5

Chain B: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	6
β-strand	9-12	4	7
β-strand	17-25	9	6
α-helix	29-31	3
β-strand	33-39	7	7
β-strand	45-51	7	7
β-strand	58-60	3	7
α-helix	62-64	3
β-strand	68-73	6	6
α-helix	74-76	3
β-strand	78-84	7	6
α-helix	88-90	3
β-strand	92-99	8	7
β-strand	104-107	4	7
β-strand	111-115	5	7
β-strand	121	1	8
β-strand	124-128	5	9
β-strand	139-149	11	9
β-strand	150	1	8
β-strand	155-158	4	10
β-strand	163	1	10
β-strand	167-169	3	9
α-helix	170-172	3
β-strand	173-175	3	9
β-strand	178-188	11	9
β-strand	198-203	6	10
α-helix	204-206	3
β-strand	208-213	6	10

Chain C: 5 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	11
β-strand	10-14	5	12
β-strand	19-25	7	11
β-strand	33-38	6	12
β-strand	45-49	5	12
β-strand	53-54	2	12
α-helix	55	1
β-strand	62-67	6	11
β-strand	70-75	6	11
α-helix	80-82	3
β-strand	84-90	7	12
β-strand	97-98	2	12
β-strand	102-107	6	12
β-strand	111	1	13
β-strand	114-118	5	14
α-helix	119-121	3
α-helix	122-127	6
β-strand	129-139	11	14
β-strand	140	1	13
β-strand	144-150	7	15
β-strand	153-155	3	15
β-strand	159-163	5	14
β-strand	173-182	10	14
α-helix	183-187	5
β-strand	191-198	8	15
β-strand	205-210	6	15

Chain D: 4 helices, 21 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	16
β-strand	11-12	2	17
β-strand	18-25	8	16
β-strand	33-39	7	18
β-strand	46-51	6	18
β-strand	57-59	3	18
β-strand	67-72	6	16
β-strand	77-82	6	16
α-helix	87-89	3
β-strand	91-98	8	18
β-strand	103-106	4	18
β-strand	110-112	3	18
β-strand	113-114	2	17
β-strand	120	1	19
β-strand	123-127	5	20
α-helix	131-135	5
β-strand	138-148	11	20
β-strand	149	1	19
β-strand	154-157	4	21
α-helix	158-160	3
β-strand	166-173	8	20
β-strand	178-187	10	20
β-strand	197-202	6	21
α-helix	203-205	3
β-strand	207-212	6	21

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (ig heavy chain V regions)	A	protein	214	Mus musculus	P01837 (AlphaFold model)
Protein (ig heavy chain V regions)	B	protein	217	Mus musculus	P01867 (AlphaFold model)
Protein (ig heavy chain V regions)	C	protein	214	Mus musculus	I6L958 (AlphaFold model)
Protein (ig heavy chain V regions)	D	protein	218	Mus musculus	P01869 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CIC_1 PROTEIN (IG HEAVY CHAIN V REGIONS) (chains A)
DIVMTQSHKFMSTSVGDRVSITCKASQDVRIAVAWYQQKPGQSPKLLIYWASTRHTGVPD
RFTGSGSGTDFTLTISNVQSEDLADYFCQHCGSYPFTFGSGTKLEIKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 2 (B), FASTA

>1CIC_2 PROTEIN (IG HEAVY CHAIN V REGIONS) (chains B)
QVQLQQPGSELVRPGASVKLSCKASGYTFTNYWMHWVKQRPGQGLEWIGNIYPGSGDSNY
DEKFKSKATLTVDTSSSTAYMQLSGLTSEDSAVYYCARGLAFYFDHWGQGTTLTVSSALT
TPPSVYPLAPGCGDTTGSSVTLGCLVKGYFPEPVTVTWNSGSLSSSVHTFPALLQSGLYT
MSSSVTVPSSTWPSETVTCSVAHPASSTTVDKKLEPS

Sequence of entity 3 (C), FASTA

>1CIC_3 PROTEIN (IG HEAVY CHAIN V REGIONS) (chains C)
DIQMTQSPASLSASVGETVTITCRASGNIHNYLAWYQQKQGKSPQLLVYYTTTLADGVPS
RFSGSGSGTQYSLKINSLQPEDFGSYYCQHFWSTPRTFGGGTKLELKRADAAPTVSIFPP
SSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLDSWTDQDSKDSTYSMSSTLT
LTKDEYERHNSYTCEATHKTSTSPIVKSFNRNEC

Sequence of entity 4 (D), FASTA

>1CIC_4 PROTEIN (IG HEAVY CHAIN V REGIONS) (chains D)
QVQLKESGPGLVAPSQSLSITCTVSGFSLTGYGVNWVRQPPGKGLEWLGMIWGDGNTDYN
SALKSRLSISKDNSKSQVFLKMNSLHTDDTARYYCARERDYRLDYWGQGTTLTVSSASTT
PPSVFPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSDLYTL
SSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVPRDC

Primary citation

Three-dimensional structure of an idiotope-anti-idiotope complex. Bentley, G.A., Boulot, G., Riottot, M.M. et al. Nature (1990) 348:254-257. DOI 10.1038/348254a0 · PubMed

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1CIC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.