1CK0: Protein)

Anti-anti-idiotypic antibody against human angiotensin II, unliganded form. Determined by X-ray diffraction at 2.5 Å resolution. Released 5 Aug 2003.

Method: X-ray diffraction
Resolution: 2.5 Å
Organism: Mus musculus
Chains: 2
Atoms: 3,324
Mol. weight: 47.56 kDa
Released: 5 Aug 2003

Explore 1CK0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CK0 contains 12 α-helices and 45 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain H: 6 helices, 22 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	7
β-strand	10-12	3	8
β-strand	18-25	8	7
β-strand	34-39	6	8
β-strand	45-51	7	8
α-helix	52B-53	3
β-strand	57-59	3	8
β-strand	67-72	6	7
β-strand	77-82	6	7
α-helix	87-89	3
β-strand	91-97	7	8
β-strand	106-107	2	8
β-strand	111-115	5	8
β-strand	121	1	9
β-strand	124-128	5	10
β-strand	140-149	10	10
β-strand	150	1	9
β-strand	155-158	4	11
α-helix	159-161	3
β-strand	163	1	11
β-strand	167-169	3	10
α-helix	170-172	3
β-strand	173-175	3	10
β-strand	178-187	10	10
α-helix	191-194	4
β-strand	198-203	6	11
α-helix	204-206	3
β-strand	208-213	6	11

Chain L: 6 helices, 23 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	10-13	4	2
β-strand	19-25	7	1
β-strand	30	1	3
β-strand	31F	1	3
β-strand	33-38	6	2
β-strand	45-49	5	2
β-strand	53-54	2	2
α-helix	55	1
β-strand	62-67	6	1
β-strand	70-75	6	1
α-helix	80-82	3
β-strand	84-90	7	2
β-strand	96-97	2	2
β-strand	101-105	5	2
β-strand	110	1	4
β-strand	113-117	5	5
α-helix	118-120	3
α-helix	121-124	4
β-strand	128-138	11	5
β-strand	139	1	4
β-strand	144-150	7	6
β-strand	152-154	3	6
β-strand	158-162	5	5
α-helix	163-166	4
β-strand	172-181	10	5
α-helix	182-186	5
β-strand	190-196	7	6
β-strand	204-209	6	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein (IgG1-kappa antibody 131 (light chain))	L	protein	216	Mus musculus	P01837 (AlphaFold model)
Protein (IgG1-kappa antibody 131 (heavy chain))	H	protein	219	Mus musculus	P01869 (AlphaFold model)

Sequence of entity 1 (L), FASTA

>1CK0_1 PROTEIN (IGG1-KAPPA ANTIBODY 131 (LIGHT CHAIN)) (chains L)
DIQLTQSPSSLAVSAGEKVTMNCKSSQNLLHSITRKNYLAWYRQKPGQSPKLLIYWASTR
GSGVPDRFTGSGSGTDFTLTISSVQAEDLAVYYCKQSYNLYTFGGGTKLEIKRADAAPTV
SIFPPSSEQLTSGGASVVCFLNNFYPKDINVKWKIDGSERQNGVLNSWTDQDSKDSTYSM
SSTLTLTKDEYERHNSYTCEATHKTSTSPIVKSFNR

Sequence of entity 2 (H), FASTA

>1CK0_2 PROTEIN (IGG1-KAPPA ANTIBODY 131 (HEAVY CHAIN)) (chains H)
QVQLQESGGGLVQPRGSLKLSCAASGFTFNTDAMNWVRQAPGKGLEWVARIRSKGFNFAT
YYADSVRDRFTISRDDSQSMLYLQMNNLKTEDTGIYYCVRGRDGEAMDYWGQGTTLTVSS
AKTTPPSVYPLAPGSAAQTNSMVTLGCLVKGYFPEPVTVTWNSGSLSSGVHTFPAVLQSD
LYTLSSSVTVPSSPRPSETVTCNVAHPASSTKVDKKIVN

Primary citation

Structures of Angiotensin II and a Phage-Display Selected Cyclic Peptide in Complex with Fab131: Making Angiotensin II Analogs. Pan, Y.H., Lee, K.H., Li, M. et al. To be published.

Other PDB entries of the same protein (UniProt P01837 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3D9A 1.2 Å, High Resolution Crystal Structure Structure of HyHel10 Fab Complexed to Hen Egg Lysozyme
1RUR 1.5 Å, Crystal Structure (I) of native Diels-Alder antibody 13G5 Fab at pH 8.0 with a data set…
2AJU 1.5 Å, Cyrstal structure of cocaine catalytic antibody 7A1 Fab'
2AJV 1.5 Å, Crystal Structure of Cocaine catalytic Antibody 7A1 Fab' in Complex with Cocaine
2W60 1.5 Å, Anti citrullinated Collagen type 2 antibody acc4
2W9D 1.57 Å, Structure of Fab fragment of the ICSM 18 - anti-Prp therapeutic antibody at 1.57 A…
3BKJ 1.59 Å, Crystal structure of Fab wo2 bound to the n terminal domain of amyloid beta peptide (1-16)
3BAE 1.59 Å, Crystal structure of Fab WO2 bound to the N terminal domain of Amyloid beta peptide (1-28)
2R1Y 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
2R2B 1.6 Å, Crystal structure of S25-2 Fab in complex with Kdo analogues
3BKM 1.6 Å, Structure of anti-amyloid-beta Fab WO2 (Form A, P212121)
3CFB 1.6 Å, High-resolution structure of blue fluorescent antibody EP2-19G2 in complex with stilbene…

Browse structure collections

About this viewer

MolViewer shows 1CK0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.