1CKS: Cyclin-dependent kinase subunit, type 2

Human CKSHS2 atomic structure: a role for its hexameric assembly in cell cycle control. Determined by X-ray diffraction at 2.1 Å resolution. Released 7 Feb 1995.

Method: X-ray diffraction
Resolution: 2.1 Å
Organism: Homo sapiens
Chains: 3
Atoms: 2,270
Mol. weight: 29.93 kDa
Released: 7 Feb 1995

Explore 1CKS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CKS contains 23 α-helices and 16 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	1
α-helix	9-11	3
β-strand	12-13	2	2
β-strand	18-19	2	2
β-strand	22-23	2	1
α-helix	24-25	2
α-helix	26-30	5
α-helix	37-39	3
α-helix	40-46	7
β-strand	58	1	3
α-helix	66-68	3
α-helix	72-74	3

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
α-helix	5-6	2
β-strand	7-8	2	4
α-helix	9-11	3
β-strand	12-13	2	5
β-strand	14	1	3
β-strand	18-19	2	5
β-strand	22-23	2	4
α-helix	26-29	4
α-helix	37-39	3
α-helix	40-45	6
β-strand	58	1	6
α-helix	59-64	6
α-helix	72-74	3
α-helix	75-77	3

Chain C: 8 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	7-8	2	7
α-helix	9-11	3
β-strand	12-13	2	8
β-strand	14	1	6
β-strand	18-19	2	8
β-strand	22-23	2	7
α-helix	24-25	2
α-helix	26-29	4
α-helix	37-39	3
α-helix	40-46	7
α-helix	62-65	4
α-helix	72-74	3
α-helix	75-77	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cyclin-dependent kinase subunit, type 2	A, B, C	protein	79	Homo sapiens	P33552 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>1CKS_1 CYCLIN-DEPENDENT KINASE SUBUNIT, TYPE 2 (chains A, B, C)
MAHKQIYYSDKYFDEHYEYRHVMLPRELSKQVPKTHLMSEEEWRRLGVQQSLGWVHYMIH
EPEPHILLFRRPLPKDQQK

Primary citation

Human CksHs2 atomic structure: a role for its hexameric assembly in cell cycle control. Parge, H.E., Arvai, A.S., Murtari, D.J. et al. Science (1993) 262:387-395. PubMed

Other PDB entries of the same protein (UniProt P33552 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6GU2 2.0 Å, CDK1/CyclinB/Cks2 in complex with Flavopiridol
5LQF 2.06 Å, CDK1/CyclinB1/CKS2 in complex with NU6102
4Y72 2.3 Å, Human CDK1/CyclinB1/CKS2 With Inhibitor
5HQ0 2.3 Å, Ternary complex of human proteins CDK1, Cyclin B and CKS2, bound to an inhibitor
6GU6 2.33 Å, CDK1/Cks2 in complex with Dinaciclib
11GY 2.4 Å, Crystal structure of selective inhibitor 16 bound at the active site of CDK1
6GU3 2.65 Å, CDK1/CyclinB/Cks2 in complex with AZD5438
4YC3 2.7 Å, CDK1/CyclinB1/CKS2 Apo
6GU4 2.73 Å, CDK1/CyclinB/Cks2 in complex with CGP74514A
6GU7 2.75 Å, CDK1/Cks2 in complex with AZD5438

Browse structure collections

About this viewer

MolViewer shows 1CKS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.