1CMF: Apo calmodulin carboxy-terminal domain

NMR solution structure of apo calmodulin carboxy-terminal domain. Determined by solution NMR. Released 7 Dec 1995.

Method: Solution NMR
Organism: Bos taurus
Chains: 1
Atoms: 586
Mol. weight: 8.42 kDa
Released: 7 Dec 1995

Explore 1CMF in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CMF contains 5 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 5 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	82-93	12
β-strand	100	1	1
α-helix	102-108	7
α-helix	118-122	5
α-helix	125-127	3
β-strand	136	1	1
α-helix	138-145	8

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Calmodulin (vertebrate)	A	protein	73	Bos taurus	P62157 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CMF_1 CALMODULIN (VERTEBRATE) (chains A)
MKDTDSEEEIREAFRVFDKDGNGYISAAELRHVMTNLGEKLTDEEVDEMIREADIDGDGQ
VNYEEFVQMMTAK

Primary citation

Calcium-induced structural changes and domain autonomy in calmodulin. Finn, B.E., Evenas, J., Drakenberg, T. et al. Nat Struct Biol (1995) 2:777-783. DOI 10.1038/nsb0995-777 · PubMed

Other PDB entries of the same protein (UniProt P62157 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IF7 1.6 Å, Structure of Calmodulin complexed with its first endogenous inhibitor,…
1FW4 1.7 Å, Crystal structure of E. Coli fragment TR2C from calmodulin to 1.7 a resolution
1PRW 1.7 Å, Crystal structure of bovine brain Ca++ calmodulin in a compact form
1CDM 2.0 Å, Modulation of calmodulin plasticity in molecular recognition on the basis of X-ray…
1CM1 2.0 Å, Motions of calmodulin-single-conformer refinement
1CM4 2.0 Å, Motions of calmodulin-four-conformer refinement
1LIN 2.0 Å, Calmodulin complexed with trifluoperazine (1:4 complex)
1XA5 2.12 Å, Structure of Calmodulin in complex with KAR-2, a bis-indol alkaloid
2F2O 2.17 Å, Structure of calmodulin bound to a calcineurin peptide: a new way of making an old…
1QIW 2.3 Å, Calmodulin complexed with N-(3,3,-diphenylpropyl)-N'-[1-R-(3,4-bis-butoxyphenyl)-ethyl]-p…
2FOT 2.45 Å, Crystal structure of the complex between calmodulin and alphaII-spectrin
2F2P 2.6 Å, Structure of calmodulin bound to a calcineurin peptide: a new way of making an old…

Browse structure collections

About this viewer

MolViewer shows 1CMF directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.