Solution structure of toxin 2 from centruroides noxius hoffmann, a beta scorpion neurotoxin acting on sodium channels, NMR, 15 structures. Determined by solution NMR. Released 13 Jan 1999.
Explore 1CN2 in 3D Show helices and sheets RCSB PDB PDBe
1CN2 contains 1 α-helix and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-4 | 2 | 1 |
| β-strand | 6 | 1 | 2 |
| β-strand | 13 | 1 | 2 |
| α-helix | 24-30 | 7 | |
| β-strand | 39-42 | 4 | 1 |
| β-strand | 45-48 | 4 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Toxin 2 | A | protein | 67 | Centruroides noxius | P01495 (AlphaFold model) |
>1CN2_1 TOXIN 2 (chains A) KEGYLVDKNTGCKYECLKLGDNDYCLRECKQQYGKGAGGYCYAFACWCTHLYEQAIVWPL PNKRCSX
Solution structure of toxin 2 from centruroides noxius Hoffmann, a beta-scorpion neurotoxin acting on sodium channels. Pintar, A., Possani, L.D., Delepierre, M. J Mol Biol (1999) 287:359-367. DOI 10.1006/jmbi.1999.2611 · PubMed
Other PDB entries of the same protein (UniProt P01495 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 1CN2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.