1CX4: PDB entry 1CX4

Crystal structure of a deletion mutant of the type II beta regulatory subunit of camp-dependent protein kinase. Determined by X-ray diffraction at 2.45 Å resolution. Released 7 Mar 2001.

Method: X-ray diffraction
Resolution: 2.45 Å
Organism: Rattus norvegicus
Chains: 1
Atoms: 2,399
Mol. weight: 34.82 kDa
Ligands: CMP
Released: 7 Mar 2001

Explore 1CX4 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

1CX4 contains 12 α-helices and 14 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 14 β-strands

Element	Residues	Length	Sheet
α-helix	137-147	11
α-helix	151-153	3
α-helix	158-167	10
β-strand	169-173	5	1
β-strand	178-180	3	2
α-helix	185-186	2
β-strand	188-194	7	1
β-strand	196-203	8	2
β-strand	206-214	9	2
β-strand	218-219	2	1
α-helix	221-226	6
β-strand	233-236	4	2
β-strand	240-246	7	1
α-helix	247-270	24
α-helix	273-275	3
α-helix	280-289	10
β-strand	291-295	5	3
β-strand	300-302	3	3
β-strand	310-324	15	3
β-strand	336-342	7	3
β-strand	347-348	2	3
α-helix	351-355	5
β-strand	362-375	14	3
α-helix	376-382	7
α-helix	384-386	3
α-helix	387-405	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Camp-dependent protein kinase regulatory subunit type II beta	A	protein	305	Rattus norvegicus	P12369 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>1CX4_1 CAMP-DEPENDENT PROTEIN KINASE REGULATORY SUBUNIT TYPE II BETA (chains A)
SVCAEAYNPDEEEDDAESRIIHPKTDDQRNRLQEACKDILLFKNLDPEQMSQVLDAMFEK
LVKEGEHVIDQGDDGDNFYVIDRGTFDIYVKCDGVGRCVGNYDNRGSFGELALMYNTPRA
ATITATSPGALWGLDRVTFRRIIVKNNAKKRKMYESFIESLPFLKSLEVSERLKVVDVIG
TKVYNDGEQIIAQGDSADSFFIVESGEVRITMKRKGKSDIEENGAVEIARCLRGQYFGEL
ALVTNKPRAASAHAIGTVKCLAMDVQAFERLLGPCMEIMKRNIATYEEQLVALFGTNMDI
VEPTA

Ligands and cofactors

ID	Name	Formula	Copies
CMP	Adenosine-3',5'-cyclic-monophosphate	C10 H12 N5 O6 P	2

Primary citation

Molecular basis for regulatory subunit diversity in cAMP-dependent protein kinase: crystal structure of the type II beta regulatory subunit. Diller, T.C., Madhusudan, Xuong, N.H. et al. Structure (2001) 9:73-82. DOI 10.1016/S0969-2126(00)00556-6 · PubMed

Other PDB entries of the same protein (UniProt P12369 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3IDB 1.62 Å, Crystal structure of (108-268)RIIb:C holoenzyme of cAMP-dependent protein kinase
4JVA 2.5 Å, Crystal Structure of RIIbeta(108-402) bound to HE33, a N6 di-propyl substituted cAMP…
3IDC 2.7 Å, Crystal structure of (102-265)RIIb:C holoenzyme of cAMP-dependent protein kinase
6WJG 6.2 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma
6WJF 7.5 Å, PKA RIIbeta holoenzyme with DnaJB1-PKAc fusion in fibrolamellar hepatoceullar carcinoma

Browse structure collections

About this viewer

MolViewer shows 1CX4 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.